y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G080800.1
FamilyCBM49
Protein PropertiesLength: 625 Molecular Weight: 68878.9 Isoelectric Point: 9.1685
ChromosomeChromosome/Scaffold: 03 Start: 19800250 End: 19804282
Descriptionglycosyl hydrolase 9C2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495336094.3e-38
  FIQQKMTTSWNEKGRTYYRYSIVMTNKSSKTLNDLKLSISKLYGPIWGLTKSGNSYGFPTHLNSLPAGKSLEFVYIH
GH9254860
  DYNQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLPMAFTITMMSWSIIEYGKPMAANGELGHAMEAVKWGTDYL
  IKAHPEPYVLYGEVGDGNTDHYCWQRPEDMTTDRHAYRIDPSNPGSDLAGETAAAMAAASIVFRRSNPAYSSELLHHAYQLFDFADKYKGKYDSSITVAQ
  KYYRSVSGYNDELLWAAAWLYQASNNQYYLNYLGKNGDSMGGTGWAMTEFGWDVKYAGVQTLVAKFLMQGKAGMHAPVFERYHQKAEHFMCSLIGKGTRN
  VQKTPGGLMFRQRWNNMQFVTSASFLATVYSDYLASSKGTLRCAAGNVAPTQLLSFAKSQVDYLLGDNPRGTSYMVGYGNNFPRQVHHRGSSIVSIKVDS
  KFIACRQGYAAWYTRKASDPNVLTGAVVGGPDAYDNFADERNNYEQTEPATYNNAPLLGILA
Full Sequence
Protein Sequence     Length: 625     Download
MEKSMSMAPL LLMVLCLPFA LGWHDYNQAL SKSILFFEAQ RSGYLPHNQR VTWRANSGLN    60
DGKASGVDLV GGYYDAGDNV KFGLPMAFTI TMMSWSIIEY GKPMAANGEL GHAMEAVKWG    120
TDYLIKAHPE PYVLYGEVGD GNTDHYCWQR PEDMTTDRHA YRIDPSNPGS DLAGETAAAM    180
AAASIVFRRS NPAYSSELLH HAYQLFDFAD KYKGKYDSSI TVAQKYYRSV SGYNDELLWA    240
AAWLYQASNN QYYLNYLGKN GDSMGGTGWA MTEFGWDVKY AGVQTLVAKF LMQGKAGMHA    300
PVFERYHQKA EHFMCSLIGK GTRNVQKTPG GLMFRQRWNN MQFVTSASFL ATVYSDYLAS    360
SKGTLRCAAG NVAPTQLLSF AKSQVDYLLG DNPRGTSYMV GYGNNFPRQV HHRGSSIVSI    420
KVDSKFIACR QGYAAWYTRK ASDPNVLTGA VVGGPDAYDN FADERNNYEQ TEPATYNNAP    480
LLGILARLGS GHSGYNQLLP EAVPVPKPVA AKPKAEPKAK STPNPATTSS PIFIQQKMTT    540
SWNEKGRTYY RYSIVMTNKS SKTLNDLKLS ISKLYGPIWG LTKSGNSYGF PTHLNSLPAG    600
KSLEFVYIHA ASPADVSVSS YNLA*                                          660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN0217101624629+
PLN02340PLN02340010622616+
PLN02420PLN02420025488466+
PLN00119PLN00119010488479+
pfam00759Glyco_hydro_9025486464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN04496.2016241620endo-1,4-beta-glucanase [Gossypium hirsutum]
EMBLCAI68019.102462426620endo-beta-1,4-glucanase [Prunus persica]
EMBLCAI68020.102462426620endo-beta-1,4-glucanase [Prunus persica]
RefSeqXP_002299478.1036246622predicted protein [Populus trichocarpa]
RefSeqXP_002303645.102462326621glycosyl hydrolase family 9 [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0244883428A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1ksc_A0244883428A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1ks8_A0244883428A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A01848818459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0256235536B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO783495378284050
ES821522357283820
CO1277432801324110
DW487290263413030
ES814611265963600
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)