y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G089600.2
FamilyGH9
Protein PropertiesLength: 592 Molecular Weight: 65590.5 Isoelectric Point: 6.6759
ChromosomeChromosome/Scaffold: 03 Start: 26028228 End: 26031047
Descriptionglycosyl hydrolase 9A1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH91005590
  ALNQAITFFDAQKSGSYPSNSPIRFRGSSGLQDGNSSNIHADLVGGFYDSGNNIKFTFPAAYTITLLSWSVVEYHRKYADIGELEHIKDVIKWGSDYLLK
  VGSAGNDTKNPVPNDINCWQRPEDMRYKRPVSVCNETASDLAGEIVAALSAASIVFKQENEYSQRLIKKAEQIYEITAKEDRIHRAITYTTIDACGGEAR
  KFYGSSGYKDELVWAATWLFFATGNHTFLDYATTNFAAAVDDETTTDKGIFYWNNKLAANAVLFTRLRFFRDLGFPYEKALGLSTNMTDQLMCSYLSKQN
  FNRTPGGLILLSPGTGGPLQFAATASFLSKLYNDYLTLLRRSSWNCTNDGFSLEMLQSFSTSQINYILGDNPKKMSYMVGFGDHYPTHVHHRSASIPWDG
  QYHSCADGDRWLHSQDRNPNILLGAMVAGPDQFDDFSDEREKTWSTEPSIAGNAGLVAAL
Full Sequence
Protein Sequence     Length: 592     Download
MAGSSNSAPV SSIHTSSETG RLLPSATKCN SKEIDLDVSL PSPYPKSYLF ELVITDKTHY    60
RRFLYISLTL AFVVLALGLV PHFLPQNNRH HGHSKNLTLA LNQAITFFDA QKSGSYPSNS    120
PIRFRGSSGL QDGNSSNIHA DLVGGFYDSG NNIKFTFPAA YTITLLSWSV VEYHRKYADI    180
GELEHIKDVI KWGSDYLLKV GSAGNDTKNP VPNDINCWQR PEDMRYKRPV SVCNETASDL    240
AGEIVAALSA ASIVFKQENE YSQRLIKKAE QIYEITAKED RIHRAITYTT IDACGGEARK    300
FYGSSGYKDE LVWAATWLFF ATGNHTFLDY ATTNFAAAVD DETTTDKGIF YWNNKLAANA    360
VLFTRLRFFR DLGFPYEKAL GLSTNMTDQL MCSYLSKQNF NRTPGGLILL SPGTGGPLQF    420
AATASFLSKL YNDYLTLLRR SSWNCTNDGF SLEMLQSFST SQINYILGDN PKKMSYMVGF    480
GDHYPTHVHH RSASIPWDGQ YHSCADGDRW LHSQDRNPNI LLGAMVAGPD QFDDFSDERE    540
KTWSTEPSIA GNAGLVAALI AHHDPPRSSA SNGPNLGLDI VGIFEKVHLD S*            600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02340PLN023405.0e-107100574491+
PLN00119PLN001195.0e-11294561480+
PLN02171PLN021711.0e-113100563495+
pfam00759Glyco_hydro_92.0e-12796559472+
PLN02345PLN023455.0e-128100559474+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAQ63883.1055697590cellulase [Medicago truncatula]
EMBLCAN71528.101058818607hypothetical protein [Vitis vinifera]
EMBLCBI19980.10644114473unnamed protein product [Vitis vinifera]
RefSeqXP_002278065.101058818618PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002526151.1045883600endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A01015619427A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ksc_A01015619427A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ks8_A01015619427A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0965595437A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0965595437A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
6385
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794674515685610
BF010444485965610
HO7962134621225610
HO778339422684680
HO778339924705610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00010.1Aquca_058_00008.1Aquca_014_00010.2Aquca_014_00403.1
Arabidopsis lyrata495032858221894138
Arabidopsis thalianaAT5G49720.1AT4G24260.1AT1G65610.1
Brachypodium distachyonBradi1g09460.1Bradi1g63560.1Bradi5g14580.1
Brassica rapaBra000594Bra040496Bra019237Bra013781Bra022470
Bra016970Bra039767
Carica papayaevm.model.supercontig_17.23evm.model.supercontig_88.37evm.model.supercontig_151.55evm.model.supercontig_49.52
Capsella rubellaCarubv10027986mCarubv10004382mCarubv10019972m
Citrus clementinaCiclev10000600mCiclev10014583mCiclev10024241mCiclev10003884mCiclev10003122m
Citrus sinensisorange1.1g007014morange1.1g007041morange1.1g013516morange1.1g046335morange1.1g013288m
orange1.1g041590morange1.1g043321m
Cucumis sativusCucsa.260330.1Cucsa.178750.1Cucsa.212770.1
Eucalyptus grandisEucgr.G00035.1Eucgr.A00393.1Eucgr.G00035.2Eucgr.F02731.1
Fragaria vescamrna29283.1-v1.0-hybridmrna25126.1-v1.0-hybrid
Glycine maxGlyma09g02160.1Glyma15g13080.1Glyma17g00710.1Glyma07g40090.1Glyma20g06820.1
Glyma06g12910.2Glyma06g12910.3Glyma04g41891.1
Gossypium raimondiiGorai.011G089500.1Gorai.010G143300.1Gorai.010G143300.2Gorai.008G141900.1Gorai.010G143300.3
Gorai.011G089500.2Gorai.003G089600.1Gorai.003G089600.3
Linum usitatissimumLus10026275Lus10012162Lus10026863Lus10018918Lus10028619
Lus10010029Lus10036331Lus10007584
Malus domesticaMDP0000225700MDP0000388002MDP0000452189MDP0000518321MDP0000313820.215.533
MDP0000313820.215.533MDP0000308015MDP0000896140MDP0000140066.486.637MDP0000140066.486.637
MDP0000221017MDP0000160026MDP0000313820.118.215MDP0000313820.118.215MDP0000144703
Manihot esculentacassava4.1_003705mcassava4.1_003712mcassava4.1_026565m
Medicago truncatulaMedtr2g028480.1Medtr3g082440.1Medtr3g090540.1Medtr4g128810.1
Mimulus guttatusmgv1a003033mmgv1a002977mmgv1a002970mmgv1a002960mmgv1a022358m
mgv1a018926mmgv1a018124mmgv1a024415mmgv1a026839m
Oryza sativaLOC_Os03g21210.1LOC_Os03g52630.1LOC_Os03g52630.2LOC_Os04g41970.1LOC_Os12g24040.1
Panicum virgatumPavirv00061241mPavirv00029143mPavirv00040687mPavirv00029144mPavirv00038435m
Pavirv00038432mPavirv00007671mPavirv00061242mPavirv00005986mPavirv00061243m
Pavirv00044338mPavirv00049329mPavirv00048097m
Physcomitrella patensPp1s190_6V6.1Pp1s157_35V6.1Pp1s35_333V6.1Pp1s15_429V6.1Pp1s64_152V6.1
Phaseolus vulgarisPhvul.003G089600.1Phvul.006G133700.1Phvul.006G004900.1Phvul.009G135900.1
Picea abiesMA_69345g0010MA_102312g0010.133.408MA_102312g0010.133.408MA_9211546g0010MA_102312g0010.413.556
MA_102312g0010.413.556MA_6683906g0010.193.294MA_6683906g0010.193.294
Populus trichocarpaPotri.003G151700.1Potri.003G151700.2Potri.001G078900.1Potri.003G151700.3Potri.010G177300.1
Potri.008G079500.1Potri.010G177300.3Potri.010G177300.2Potri.003G151700.4Potri.005G188500.1
Potri.002G071200.1
Prunus persicappa002911mppa014845mppa026228mppa019140m
Ricinus communis30063.m00143629929.m00450230076.m00469627985.m000864
Setaria italicaSi034713mSi009616mSi012680mSi035386m
Selaginella moellendorffii26652275214
Sorghum bicolorSb01g036480.1Sb01g008860.1Sb06g021440.1
Thellungiella halophilaThhalv10012978mThhalv10024681mThhalv10018270mThhalv10003366mThhalv10012932m.108.387
Thhalv10012932m.108.387Thhalv10012932m.412.610Thhalv10012932m.412.610
Vitis viniferaGSVIVT01023102001GSVIVT01006265001GSVIVT01010049001GSVIVT01006152001
Zea maysAC199765.4_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)