y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G090000.1
FamilyAA2
Protein PropertiesLength: 136 Molecular Weight: 14459.8 Isoelectric Point: 6.4885
ChromosomeChromosome/Scaffold: 03 Start: 26403890 End: 26405161
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2531352.6e-26
  AVDDNPRNAAILLRLHFHDCFVQGCDGSILIRNDEDGELKAQGNLGVVGFDIIDSAKARLENLCPGIVSCADIVSLAARDAVS
Full Sequence
Protein Sequence     Length: 136     Download
MQKGNTQIAL ILASLIISNI IVLVVSQGQL RVGFYSKTCP NAESIIRKVV QKAVDDNPRN    60
AAILLRLHFH DCFVQGCDGS ILIRNDEDGE LKAQGNLGVV GFDIIDSAKA RLENLCPGIV    120
SCADIVSLAA RDAVS*                                                    180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like5.0e-744135101+
pfam00141peroxidase9.0e-384613591+
PLN03030PLN030301.0e-4227134109+
cd00693secretory_peroxidase1.0e-6129135109+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU17962.18.00141e-4381351127unknown [Glycine max]
EMBLCAE54309.1011351135peroxidase [Gossypium hirsutum]
RefSeqNP_177835.24.06377e-44813521147peroxidase, putative [Arabidopsis thaliana]
Swiss-ProtO492932.94273e-4481354130PER13_ARATH RecName: Full=Peroxidase 13; Short=Atperox P13; Flags: Precursor
RefSeqXP_002278472.12.99878e-431113417140PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A5e-32291352111A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1pa2_A5e-32291352111A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B4e-31291341109A Chain A, Peanut Peroxidase
PDB1sch_A4e-31291341109A Chain A, Peanut Peroxidase
PDB4a5g_B5e-30281352112A Chain A, Raphanus Sativus Anionic Peroxidase.
Transmembrane Domains
StartEnd
726
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JK80441213511350
CO499344109271350
CO498668109271350
CO495338109271350
BQ404381109271350
Orthologous Group
SpeciesID
Gossypium raimondiiGorai.003G090000.2
Sequence Alignments
Phylogeny