y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.003G138400.1
FamilyGH18
Protein PropertiesLength: 265 Molecular Weight: 29791.3 Isoelectric Point: 6.2423
ChromosomeChromosome/Scaffold: 03 Start: 39990460 End: 39991254
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18201901.1e-23
  HFILSFAIDYDTSTSPSPTNGKFNVFWDSTNLSPSHVSSIKSKHPNVKVAISLGGYTVGSQFAYFKPSTVRSWVANAVTSLTSIIKKYNLDGIDIDYEHF
  QADPQTFAESIGLLIKTLKRNKVISFASIAPYADNEVQRQYLALWNKHGDIIDYVNFQFYAYDKGTTIPQF
Full Sequence
Protein Sequence     Length: 265     Download
AEFKDVKFSD VPINPNVDFH FILSFAIDYD TSTSPSPTNG KFNVFWDSTN LSPSHVSSIK    60
SKHPNVKVAI SLGGYTVGSQ FAYFKPSTVR SWVANAVTSL TSIIKKYNLD GIDIDYEHFQ    120
ADPQTFAESI GLLIKTLKRN KVISFASIAP YADNEVQRQY LALWNKHGDI IDYVNFQFYA    180
YDKGTTIPQF LSYFNNQSSN YNGGKVLVSF QSDVRRGLTP EDGFFDACNM LKSQQRLHGI    240
FVWSADDSKA DGFIYEKQSQ EILD*                                          300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02871GH18_chitinase_D-like7.0e-99179184+
smart00636Glyco_184.0e-1120182179+
pfam00704Glyco_hydro_184.0e-1520181171+
cd00598GH18_chitinase-like7.0e-1713179172+
cd06544GH18_narbonin7.0e-1191248249+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19368.10126341304unknown [Glycine max]
RefSeqXP_002281665.10126338300PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318148.10126335297predicted protein [Populus trichocarpa]
RefSeqXP_002532811.10126339301Chitinase 1 precursor, putative [Ricinus communis]
RefSeqXP_002532812.10126344306Chitinase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3sim_B0326312273A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB3sim_A0326312273A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB1nar_A7e-351726331287A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
PDB4ay1_L0.00006718020191A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties
PDB4ay1_K0.00006718020191A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DN82720823482410
DN82758723082370
FQ31649226312630
FQ31709926312630
FQ31707126312630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_046_00008.1Aquca_014_00353.1Aquca_010_00636.1Aquca_027_00184.1
Brachypodium distachyonBradi3g26850.1Bradi3g26810.1Bradi3g26840.1
Carica papayaevm.model.supercontig_139.6
Citrus clementinaCiclev10028881mCiclev10003729m
Citrus sinensisorange1.1g021511morange1.1g046094m
Eucalyptus grandisEucgr.B02439.1Eucgr.J02106.1
Fragaria vescamrna14033.1-v1.0-hybrid.59.211mrna14019.1-v1.0-hybridmrna15882.1-v1.0-hybridmrna14034.1-v1.0-hybridmrna17899.1-v1.0-hybrid
mrna22564.1-v1.0-hybrid
Glycine maxGlyma11g15512.1Glyma09g21615.1Glyma13g40590.1
Gossypium raimondiiGorai.003G135700.1Gorai.003G135800.1Gorai.003G134100.1Gorai.003G129600.1Gorai.011G120000.1
Linum usitatissimumLus10005172
Malus domesticaMDP0000904158MDP0000885802MDP0000644797MDP0000312089
Manihot esculentacassava4.1_024209mcassava4.1_027074m
Medicago truncatulaMedtr6g079630.1Medtr2g096030.1
Mimulus guttatusmgv1a019267mmgv1a024804m
Oryza sativaLOC_Os10g28050.1LOC_Os10g28080.1
Panicum virgatumPavirv00061810mPavirv00014582mPavirv00031712m
Phaseolus vulgarisPhvul.011G069900.1
Picea abiesMA_38396g0010MA_10427109g0010
Populus trichocarpaPotri.012G102400.1Potri.015G100500.1Potri.015G100600.1Potri.001G341700.1
Prunus persicappa023801mppa009038mppa009096m
Ricinus communis30039.m00023530039.m000234
Setaria italicaSi022612mSi026720mSi028172mSi036765mSi036774m
Selaginella moellendorffii41118115493
Sorghum bicolorSb01g021920.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny