y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G009500.1
FamilyGT29
Protein PropertiesLength: 390 Molecular Weight: 44850.9 Isoelectric Point: 9.5344
ChromosomeChromosome/Scaffold: 04 Start: 691046 End: 692215
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291593680
  FIGTNKYKSCAIVGNSGILLNKKYGNLIDDYEIVIRLNNARIKGFEKQVGTKTNISFVNSNVLHLCAKGGESCFCDPYGPNVPIVMYICQLVHFADYVMC
  NSSHEAPMLVTDPRFDVLCARIVKYYSVKRFVEEMGKTLDEWGPVHDGSLFHYSSGFQAVMLALGICDKVGMFGFGKSASTAHHYHTNQKAELRLHDYEA
  EYEFYHDLVK
Full Sequence
Protein Sequence     Length: 390     Download
MKGSIRPLLS ILMLVVFATT LTFRIFIYGR RVFTVAATQQ PSPTQTFNST LLNFAAIDIG    60
EEKSKLEIDQ LLERNYDNER RTTGYTTWRR FNHYDAKAKA KSKRDNKLLV MFKSPKFHHY    120
WLDFRRNLQD WARKKVFQPN IMMELVQLVK VPIDGYNGFI GTNKYKSCAI VGNSGILLNK    180
KYGNLIDDYE IVIRLNNARI KGFEKQVGTK TNISFVNSNV LHLCAKGGES CFCDPYGPNV    240
PIVMYICQLV HFADYVMCNS SHEAPMLVTD PRFDVLCARI VKYYSVKRFV EEMGKTLDEW    300
GPVHDGSLFH YSSGFQAVML ALGICDKVGM FGFGKSASTA HHYHTNQKAE LRLHDYEAEY    360
EFYHDLVKNP RAIPFVSDKF RFPPVVIYR*                                     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_295.0e-30163368223+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ15145.10133891384sialyltransferase-like protein [Gossypium raimondii]
EMBLCAN64919.1013881388hypothetical protein [Vitis vinifera]
RefSeqXP_002277132.1013881388PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306228.1013891390predicted protein [Populus trichocarpa]
RefSeqXP_002523786.10138946434sialyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000000000516634998264A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB2wnb_A0.0000000000516634998264A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.0000000000516634998264A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CU5391802321333630
DR9397892501413900
CO120268287122860
CN9480462171643800
CB0072132221693900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00099.1
Arabidopsis lyrata470889
Arabidopsis thalianaAT1G08280.1
Brachypodium distachyonBradi5g15097.1Bradi4g42490.1Bradi2g55530.1
Brassica rapaBra018639
Carica papayaevm.model.supercontig_32.97
Capsella rubellaCarubv10009362m
Citrus clementinaCiclev10028611m
Citrus sinensisorange1.1g045324m
Cucumis sativusCucsa.385070.1
Eucalyptus grandisEucgr.B03871.2Eucgr.B03871.1Eucgr.B03872.1
Fragaria vescamrna22044.1-v1.0-hybrid
Glycine maxGlyma12g09360.1Glyma12g09380.1Glyma12g09370.1Glyma11g19080.1
Gossypium raimondiiGorai.009G086400.1Gorai.001G121600.1Gorai.001G121600.2
Linum usitatissimumLus10043382Lus10019538
Malus domesticaMDP0000819808MDP0000297352MDP0000232578
Manihot esculentacassava4.1_025383mcassava4.1_029496m
Medicago truncatulaMedtr4g053520.1
Mimulus guttatusmgv1a007914m
Oryza sativaLOC_Os01g63970.1LOC_Os04g42760.1LOC_Os12g05550.1
Panicum virgatumPavirv00000013mPavirv00026461mPavirv00017508mPavirv00017918mPavirv00063645m
Pavirv00039153mPavirv00003354mPavirv00055978m
Physcomitrella patensPp1s66_22V6.1Pp1s258_38V6.1Pp1s269_58V6.1
Phaseolus vulgarisPhvul.011G093000.1
Picea abiesMA_473578g0010MA_5257g0010MA_76451g0010MA_10437278g0030MA_10426176g0010
MA_180941g0010
Populus trichocarpaPotri.009G144000.1Potri.004G184200.1
Prunus persicappa006961m
Ricinus communis30055.m001540
Setaria italicaSi010021mSi001764mSi028299mSi012629mSi027686m
Selaginella moellendorffii133452589
Sorghum bicolorSb05g003170.1Sb05g003150.1Sb06g021930.1Sb05g003160.1Sb03g040480.1
Thellungiella halophilaThhalv10007826m
Vitis viniferaGSVIVT01036150001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny