y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G018200.3
FamilyGT48
Protein PropertiesLength: 1761 Molecular Weight: 202906 Isoelectric Point: 8.5475
ChromosomeChromosome/Scaffold: 04 Start: 1300844 End: 1327858
Descriptionglucan synthase-like 10
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4888416150
  VPKNLEARRRLEFFTNSLFMDMPPARPVQEMLSFSVFTPYYSEIVLYSMNELLKKNEDGISILFYLQKIYPDEWKNFLARIGRDENAAETELYDSPSDIL
  ELRFWASYRGQTLARTVRGMMYYRKALMLQTYLERENAGDTEAALSRLETTDTQGYELSPEARARADLKFTYVVTCQIYGRQKEEQKPEAADIALLMQRN
  EALRVAFIDVVETLKDGKVHTEYYSKLVKADINGKDKEIYAIKLPGDPKLGEGKPENQNHAIVFTRGNAVQTIDMNQDNYFEEALKVRNLLEEFDRDHGI
  RPPTILGVREHVFTGSVSSLASFMSNQESCFVTLGQRVLATPLKVRMHYGHPDVFDRVFHITRGGISKASRIINISEDIYAGFNSTLRQGNITHHEYIQV
  GKGRDVGLNQIALFEGKVAGGNGEQVLSRDVYRLGQLFDFFRMMSFYFTTVGFYFCTMLTVLTVYIFLYGRAYLALSGVGETMQRRAQIMDNAALEAALN
  TQFLFQIGIFSAVPMVLGFILEQGFLRAIVSFITMQLQLCTVFFTFSLGTRTHYFGRTILHGGARYQATGRGFVVRHIKFSENYRLYSRSHFVKGLEVVL
  LLVVYLAYGYSDSALSYILLSISSWFMALSWLFAPYLFNPSGFEWQKIVEDFRDWTNWLFYRGGIGVKGEESWEAWWDEELAHIRTMRGRILETILSLRF
  FLFQYGVVYKLNVQGTDTSLTVYGFSWVVLAV
Full Sequence
Protein Sequence     Length: 1761     Download
MMLRESGVFS GNLGELERKT LKRKRVFGTL RVLGMVLQQL TEEIPVELKR VIDSDAAMTE    60
DLIAYNIIPF PLDAPTITNA IVSFPEVRAA VSALKHDRSL PKLPSDFSIP ETRSPDLMDF    120
LHYVFGFQKD NVSNQREHVV LLLANEQSRH GIPEEPEPKL DEAAVQKVFL KSLDNYIKWC    180
NYLCIQPVWS NLDAVNKEKK VLFVSLYFLI WGEAANIRFL PECLCYIFHH MAREMDEALR    240
QHIAQPANSC SKDGVVSFLD QVITPLYDVV AAEAANNENG RAPHSAWRNY DDFNEYFWSL    300
HCFDLSWPWR KTSFFQKPEP RSKNPLKLGG GQHRGKTSFV EHRTFFHLYH SFHRLWIFLV    360
MMFQGLTIIA FNNGHLNAKT LREVLSLGPT FVVMKFTESV LDVIMMYGAY STTRRLAVSR    420
IFLRFIWFSI ASVFVSFLYV RALQEESKPN SNSVVFRLYL IVIGIYGGIH FFISFLMRIP    480
ACHRLTELCD HLSLIRFIKW MRQERYYVGR GMYERTTDFI KYMIFWLIIL SGKFAFAYFF    540
QIKPLVKPTR TVLTMDNIEY SWHDFVSRNN HNALTVVCLW APVIAMYLLD IYLFYTVLSA    600
VWGFLLGARD RLGEIRSLDA VQKLFEEFPD AFMKRLHPVR ASASSSSEAV EKSKFDAARF    660
SPFWNEIIKN LREEDYLTNF EMELLFMPKN TGKLPLVQWP LFLLASKIFL AKDIAAESRD    720
SQDELWERIS RDEYMKYAVQ ECYYALRYIL TAILEAEGRT WVERIYEGIE ASITKKTISD    780
DFQLNKLQLV ISRVTALLGI LNQAEKPEHE KGAVKAVQDL YDVVRHDVLA IYLREHSDQW    840
QSILKARTEG RLFAKLNWPR DPELKAQVKR LYSLLTIKDS ASNVPKNLEA RRRLEFFTNS    900
LFMDMPPARP VQEMLSFSVF TPYYSEIVLY SMNELLKKNE DGISILFYLQ KIYPDEWKNF    960
LARIGRDENA AETELYDSPS DILELRFWAS YRGQTLARTV RGMMYYRKAL MLQTYLEREN    1020
AGDTEAALSR LETTDTQGYE LSPEARARAD LKFTYVVTCQ IYGRQKEEQK PEAADIALLM    1080
QRNEALRVAF IDVVETLKDG KVHTEYYSKL VKADINGKDK EIYAIKLPGD PKLGEGKPEN    1140
QNHAIVFTRG NAVQTIDMNQ DNYFEEALKV RNLLEEFDRD HGIRPPTILG VREHVFTGSV    1200
SSLASFMSNQ ESCFVTLGQR VLATPLKVRM HYGHPDVFDR VFHITRGGIS KASRIINISE    1260
DIYAGFNSTL RQGNITHHEY IQVGKGRDVG LNQIALFEGK VAGGNGEQVL SRDVYRLGQL    1320
FDFFRMMSFY FTTVGFYFCT MLTVLTVYIF LYGRAYLALS GVGETMQRRA QIMDNAALEA    1380
ALNTQFLFQI GIFSAVPMVL GFILEQGFLR AIVSFITMQL QLCTVFFTFS LGTRTHYFGR    1440
TILHGGARYQ ATGRGFVVRH IKFSENYRLY SRSHFVKGLE VVLLLVVYLA YGYSDSALSY    1500
ILLSISSWFM ALSWLFAPYL FNPSGFEWQK IVEDFRDWTN WLFYRGGIGV KGEESWEAWW    1560
DEELAHIRTM RGRILETILS LRFFLFQYGV VYKLNVQGTD TSLTVYGFSW VVLAVLIILF    1620
KVFTFSQKMS VNFQLLLRFI QGVSFMIAIA GLAVAVALTD LSIPDIFASI LAFVPTGWGI    1680
LSIATAWKPF VKKTGLWKSV RSMARLYDAG MGMVIFVPIA FFSWFPFVST FQTRLMFNQA    1740
FSRGLEISLI LAGNNPNTAL *                                              1800
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam14288FKS1_dom13.0e-48198310114+
pfam02364Glucan_synthase08841625829+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD25952.10117601401899AF085717_1 putative callose synthase catalytic subunit [Gossypium hirsutum]
RefSeqNP_187372.40317601421941ATGSL10 (glucan synthase-like 10); 1,3-beta-glucan synthase [Arabidopsis thaliana]
Swiss-ProtQ9SFU60317601421931CALS9_ARATH RecName: Full=Callose synthase 9; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 10
RefSeqXP_002285644.10117601411905PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002528123.101176012819141,3-beta-glucan synthase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
355377
384406
421443
455477
522540
576598
13291351
13821404
14091431
14751494
14991521
15741591
16011623
16361658
16631685
17061728
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO78074650691414190
HS383332395106914630
HO8018342836569380
HO80183419493711300
DY26843734895112980
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1Gorai.003G109000.2
Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2Gorai.005G201500.1
Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2Gorai.004G092500.1
Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1Gorai.009G169700.3
Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2Gorai.012G187400.1
Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1Gorai.005G042700.1
Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)