y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G030700.2
FamilyGH16
Protein PropertiesLength: 282 Molecular Weight: 31685.6 Isoelectric Point: 7.9056
ChromosomeChromosome/Scaffold: 04 Start: 2438214 End: 2439556
DescriptionXyloglucan endotransglucosylase/hydrolase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16392018.9e-27
  ENGNLLTLTLDKFSGSGFQSKNQYLFGKIDMNIKLVPGNSAGTVTTYYLRSEGSTWDEIDFEFLGNLSGDPYIVHTNVYTQGKGDKEQQFYLWFDPTKDF
  HTYSLLWNPQRIIFSVDGTPIREFKNLESKGVAFPKSQPMRVYSSLWNADDWATRGGLVKTDW
Full Sequence
Protein Sequence     Length: 282     Download
MRSSLLVSVV ISLVIVASAA NFNQDIDVTW GDGRGKILEN GNLLTLTLDK FSGSGFQSKN    60
QYLFGKIDMN IKLVPGNSAG TVTTYYLRSE GSTWDEIDFE FLGNLSGDPY IVHTNVYTQG    120
KGDKEQQFYL WFDPTKDFHT YSLLWNPQRI IFSVDGTPIR EFKNLESKGV AFPKSQPMRV    180
YSSLWNADDW ATRGGLVKTD WSQAPFTASY RTFKADACVW SSGKSSCSST SSPSQNSWLS    240
QELDIASQQR LKWVQKNYMI YNYCTDTKRF PMGLPKECTA S*                       300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00413Glyco_hydrolase_162.0e-2438195173+
cd02183GH16_fungal_CRH1_transglycosylase9.0e-2639211188+
pfam00722Glyco_hydro_161.0e-7822202183+
PLN03161PLN031613.0e-11121278261+
cd02176GH16_XET2.0e-14521278260+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU21249.101328120287unknown [Glycine max]
EMBLCAD87535.1032784280putative xyloglucan endotransglycosylase [Cucumis sativus]
EMBLCAN80250.1012811284hypothetical protein [Vitis vinifera]
RefSeqXP_002270299.1012811282PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002526228.1012811284Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B02227817272A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB1un1_A02227817272A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB1umz_B02227817272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A02227817272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2uwb_B01827816267A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT563746260212800
DW519294262212820
DT465342253212730
JG856543244212640
DW227438247212670
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_067_00021.1Aquca_133_00020.1Aquca_024_00022.4Aquca_024_00022.3Aquca_024_00022.2
Aquca_024_00021.2Aquca_024_00021.1Aquca_016_00256.1Aquca_003_00770.1Aquca_024_00022.1
Aquca_005_00378.2Aquca_005_00378.1Aquca_022_00058.1Aquca_037_00308.1Aquca_068_00057.1
Aquca_043_00081.1Aquca_068_00058.1Aquca_024_00021.3Aquca_004_00167.1Aquca_016_00256.2
Aquca_002_01199.1Aquca_133_00018.1Aquca_043_00083.1Aquca_001_00359.1Aquca_012_00139.1
Aquca_127_00003.2Aquca_127_00003.1Aquca_001_00358.1
Arabidopsis lyrata490836480350488211496809480225
490240479888493497343582913451
495852354208918931495853329091
494858475629491722491721471290
858417491872475586
Arabidopsis thalianaAT4G37800.1AT5G13870.1AT5G65730.1AT2G06850.1AT4G03210.1
AT4G14130.1AT3G23730.1AT5G57530.1AT4G03210.2AT5G57540.1
AT2G18800.1AT4G30270.1AT5G57560.1AT5G57550.1AT4G25810.1
AT2G14620.1AT4G25820.1AT5G48070.1AT1G65310.1AT4G30280.1
AT4G30290.1AT1G11545.1AT4G28850.1
Brachypodium distachyonBradi4g16990.1Bradi1g33810.1Bradi1g33840.1Bradi1g33817.1Bradi5g20726.1
Bradi5g22907.1Bradi1g33827.1Bradi3g18690.1Bradi1g25847.1Bradi3g31767.1
Bradi3g10290.1Bradi3g10310.1Bradi5g20734.1Bradi5g20742.1Bradi3g18607.1
Brassica rapaBra034193Bra017855Bra006220Bra024415Bra008796
Bra000840Bra013164Bra038442Bra014975Bra011179
Bra002723Bra024089Bra020436Bra002719Bra013922
Bra008806Bra002722Bra040716Bra020434Bra020432
Bra020433Bra019141Bra013923Bra002720Bra002718
Bra010292Bra038819Bra024087Bra024088Bra010291
Bra011181Bra011180Bra010290Bra019846Bra011066
Carica papayaevm.model.supercontig_233.23evm.model.supercontig_70.34evm.model.supercontig_38.50evm.model.supercontig_129.52evm.model.supercontig_157.21
evm.model.supercontig_233.25evm.model.supercontig_233.22evm.model.supercontig_34.46evm.model.supercontig_95.62evm.model.supercontig_233.26
evm.model.supercontig_233.21evm.TU.contig_27001.5evm.model.supercontig_233.24evm.model.supercontig_198.12
Capsella rubellaCarubv10005387mCarubv10001606mCarubv10001605mCarubv10026888mCarubv10014286m
Carubv10001618mCarubv10005405mCarubv10014298mCarubv10027984mCarubv10027622m
Carubv10015626mCarubv10014279mCarubv10005183mCarubv10026914mCarubv10026912m
Carubv10005412mCarubv10028369mCarubv10009849mCarubv10006309mCarubv10027651m
Carubv10007207mCarubv10005373mCarubv10005455mCarubv10006385m
Citrus clementinaCiclev10029863mCiclev10016123mCiclev10028958mCiclev10028851mCiclev10005561m
Ciclev10016129mCiclev10026210mCiclev10010858mCiclev10008951mCiclev10008778m
Ciclev10009119mCiclev10009118mCiclev10009172mCiclev10010760mCiclev10010798m
Ciclev10010722mCiclev10010412mCiclev10010151mCiclev10010330mCiclev10010859m
Ciclev10013733mCiclev10013680mCiclev10015776mCiclev10010531m
Citrus sinensisorange1.1g022638morange1.1g022696morange1.1g020962morange1.1g022821morange1.1g023112m
orange1.1g023581morange1.1g023204morange1.1g023431morange1.1g023337morange1.1g039255m
orange1.1g022933morange1.1g045763morange1.1g047166morange1.1g036092morange1.1g036067m
orange1.1g040673morange1.1g045443morange1.1g028152morange1.1g038982morange1.1g022405m
orange1.1g028253m
Cucumis sativusCucsa.002250.1Cucsa.148190.1Cucsa.092360.1Cucsa.092370.1Cucsa.092340.1
Cucsa.092330.1Cucsa.089740.1Cucsa.172970.1Cucsa.089730.1Cucsa.092350.1
Cucsa.298590.1Cucsa.185390.1Cucsa.185400.1Cucsa.185410.1Cucsa.092380.1
Cucsa.326860.1Cucsa.086060.1Cucsa.326890.1Cucsa.340750.1
Eucalyptus grandisEucgr.I00659.1Eucgr.G01909.1Eucgr.J01663.1Eucgr.C00176.1Eucgr.K00883.1
Eucgr.C00179.1Eucgr.C00178.1Eucgr.C00184.1Eucgr.C00181.1Eucgr.C00180.2
Eucgr.C00180.1Eucgr.H02634.1Eucgr.C03800.1Eucgr.C02203.1Eucgr.A01968.1
Eucgr.H00623.1Eucgr.H00619.1Eucgr.B01596.1Eucgr.G01182.1Eucgr.G01174.1
Eucgr.L03394.1Eucgr.C00175.1Eucgr.D01294.1Eucgr.A01966.1Eucgr.A01967.1
Fragaria vescamrna05591.1-v1.0-hybridmrna00216.1-v1.0-hybridmrna05204.1-v1.0-hybridmrna01986.1-v1.0-hybridmrna12291.1-v1.0-hybrid
mrna28696.1-v1.0-hybrid.108.274mrna28696.1-v1.0-hybrid.108.274mrna24871.1-v1.0-hybridmrna19782.1-v1.0-hybridmrna19781.1-v1.0-hybrid
mrna19783.1-v1.0-hybridmrna06605.1-v1.0-hybridmrna28697.1-v1.0-hybridmrna28696.1-v1.0-hybrid.400.563mrna28696.1-v1.0-hybrid.400.563
mrna28698.1-v1.0-hybridmrna19553.1-v1.0-hybridmrna28699.1-v1.0-hybridmrna09279.1-v1.0-hybrid
Glycine maxGlyma17g16890.2Glyma05g23170.1Glyma01g40460.1Glyma02g07610.1Glyma16g04950.1
Glyma19g28220.1Glyma11g04820.1Glyma16g04960.1Glyma06g45860.2Glyma12g10960.1
Glyma13g00280.1Glyma17g07250.1Glyma13g01120.1Glyma13g38040.1Glyma17g07220.1
Glyma12g32390.1Glyma13g01140.1Glyma17g07270.1Glyma17g07260.1Glyma17g07240.1
Glyma17g07280.1Glyma13g01150.1Glyma13g01110.1Glyma15g18360.1Glyma09g07070.1
Glyma02g45670.1Glyma20g27380.1Glyma14g03140.1Glyma10g40040.1Glyma18g12690.1
Glyma09g32630.1Glyma01g34770.1Glyma08g04020.1Glyma08g12800.1Glyma05g29690.1
Glyma10g39760.1Glyma05g28310.2Glyma08g11300.2Glyma11g36730.2Glyma18g00630.3
Glyma20g27970.1Glyma16g26630.1
Gossypium raimondiiGorai.007G228100.2Gorai.007G228100.1Gorai.007G068800.4Gorai.007G068800.2Gorai.007G068800.1
Gorai.007G057400.2Gorai.003G033600.1Gorai.008G094900.2Gorai.008G094900.1Gorai.013G072200.1
Gorai.005G208300.1Gorai.008G086800.1Gorai.009G337400.1Gorai.007G057400.1Gorai.007G068800.3
Gorai.003G052400.1Gorai.009G006300.1Gorai.005G113400.1Gorai.009G006400.1Gorai.011G034600.1
Gorai.005G025000.3Gorai.005G025000.2Gorai.005G113400.2Gorai.004G031100.1Gorai.002G150800.1
Gorai.004G030600.1Gorai.002G213300.1Gorai.004G030500.1Gorai.009G079800.1Gorai.007G057400.3
Gorai.011G016500.1Gorai.010G177300.1Gorai.004G030700.1Gorai.009G158400.1Gorai.010G074000.1
Gorai.010G177300.2Gorai.007G068800.6
Linum usitatissimumLus10039643Lus10011597Lus10035654Lus10030923Lus10040121
Lus10003022Lus10011052Lus10039715Lus10018503Lus10020773
Lus10021638Lus10007349Lus10007348Lus10031586Lus10020772
Lus10000678Lus10028947Lus10011112Lus10010938Lus10031393
Lus10010939Lus10010936Lus10034098Lus10031392Lus10003048
Lus10004723Lus10012978Lus10030484Lus10015529Lus10008522
Lus10020000Lus10023221Lus10011982Lus10004580Lus10018365
Lus10007645
Malus domesticaMDP0000310152MDP0000269483MDP0000333317MDP0000661960MDP0000323987
MDP0000140678MDP0000398765MDP0000225088MDP0000873667MDP0000158544
MDP0000842877MDP0000320017MDP0000361876MDP0000258661MDP0000272671
MDP0000378203MDP0000132431MDP0000778955MDP0000264061MDP0000281777
MDP0000182058MDP0000151934MDP0000128432MDP0000173145MDP0000181544
Manihot esculentacassava4.1_013044mcassava4.1_013187mcassava4.1_013025mcassava4.1_013014mcassava4.1_012992m
cassava4.1_013520mcassava4.1_013942mcassava4.1_011585mcassava4.1_013011mcassava4.1_013342m
cassava4.1_013291mcassava4.1_013015mcassava4.1_013489mcassava4.1_032650mcassava4.1_013118m
cassava4.1_013286mcassava4.1_022330mcassava4.1_013165mcassava4.1_022350mcassava4.1_025832m
cassava4.1_027991mcassava4.1_016007mcassava4.1_012844m
Medicago truncatulaMedtr4g097670.1Medtr4g097640.1Medtr7g084770.1Medtr7g084760.1Medtr3g084630.1
Medtr3g084620.1Medtr4g126920.1Medtr7g084750.1Medtr7g093530.1Medtr8g102220.1
Medtr4g128580.1Medtr2g089140.1Medtr4g128410.1Medtr5g091730.1Medtr4g097700.1
Medtr2g038860.1Medtr4g128400.1Medtr4g128590.1Medtr8g102910.1Medtr6g088320.1
Medtr3g089540.1AC225528_49.1Medtr2g089140.2
Mimulus guttatusmgv1a011021mmgv1a011061mmgv1a011266mmgv1a011123mmgv1a011017m
mgv1a011641mmgv1a011611mmgv1a021830mmgv1a009848mmgv1a022549m
mgv1a009847mmgv1a023025mmgv1a011962mmgv1a018742mmgv1a022262m
mgv1a018934mmgv1a011220mmgv1a011275mmgv1a021219mmgv1a011456m
mgv1a011198mmgv1a010851mmgv1a021303m
Oryza sativaLOC_Os11g33270.1LOC_Os06g48160.1LOC_Os04g51520.1LOC_Os06g48170.1LOC_Os06g48200.1
LOC_Os04g53950.2LOC_Os07g34580.1LOC_Os06g48180.1LOC_Os04g51450.1LOC_Os08g14210.1
LOC_Os06g22919.4LOC_Os06g22919.3LOC_Os06g22919.2LOC_Os06g22919.1LOC_Os02g17900.1
LOC_Os02g17880.1LOC_Os04g51460.1LOC_Os08g13980.1LOC_Os08g14200.1
Panicum virgatumPavirv00001362mPavirv00009390mPavirv00058209mPavirv00006546mPavirv00053944m
Pavirv00047498mPavirv00052444mPavirv00064709mPavirv00052738mPavirv00060659m
Pavirv00038960mPavirv00054974mPavirv00040914mPavirv00035345mPavirv00066505m
Pavirv00038273mPavirv00022914mPavirv00036695mPavirv00058547mPavirv00033346m
Pavirv00045223mPavirv00047855mPavirv00059996mPavirv00032632mPavirv00050864m
Pavirv00009595mPavirv00009389mPavirv00045224mPavirv00026797mPavirv00009596m
Pavirv00034270m
Physcomitrella patensPp1s4_43V6.3Pp1s4_43V6.1Pp1s309_38V6.2Pp1s309_38V6.1Pp1s168_54V6.1
Pp1s168_29V6.1Pp1s291_89V6.1Pp1s193_16V6.1Pp1s618_1V6.1Pp1s26_126V6.1
Pp1s309_41V6.1Pp1s4_32V6.1Pp1s272_49V6.1Pp1s309_28V6.2Pp1s309_28V6.1
Phaseolus vulgarisPhvul.003G231900.1Phvul.011G107000.1Phvul.001G098200.1Phvul.004G062400.1Phvul.002G008400.1
Phvul.001G098300.1Phvul.003G147700.1Phvul.003G137600.1Phvul.005G111300.1Phvul.003G147400.1
Phvul.001G265300.1Phvul.003G147500.1Phvul.007G048300.1Phvul.009G233200.1Phvul.002G244000.1
Phvul.006G033800.1Phvul.004G168700.1Phvul.003G147300.1Phvul.002G311200.1Phvul.007G052800.1
Phvul.003G147600.1
Picea abiesMA_103594g0010MA_476450g0010MA_10428415g0010MA_10168001g0010MA_465930g0010
MA_8261658g0010MA_10251013g0010MA_8367646g0010MA_409361g0010MA_275059g0010
MA_39487g0010MA_10430695g0010MA_10432086g0010MA_144503g0010MA_148g0020
MA_17973g0010MA_19153g0010MA_10429607g0020MA_848882g0010MA_342978g0010
MA_11177g0010MA_10430703g0010MA_81735g0010MA_96657g0010MA_208401g0010
MA_10434153g0020
Populus trichocarpaPotri.007G008500.5Potri.007G008500.4Potri.007G008500.3Potri.007G008500.2Potri.007G008500.1
Potri.014G140300.1Potri.003G159700.3Potri.003G159700.1Potri.001G071000.1Potri.014G146100.1
Potri.002G060500.1Potri.T180200.1Potri.006G071200.1Potri.005G201200.1Potri.002G236200.1
Potri.013G005700.1Potri.018G095200.1Potri.018G095100.2Potri.018G095100.1Potri.013G152400.1
Potri.019G125000.1Potri.011G077300.1Potri.T112300.1Potri.002G060400.1Potri.006G170100.1
Potri.006G170000.1Potri.006G169900.1Potri.005G007200.1Potri.009G083800.1Potri.018G094900.1
Potri.018G094800.1Potri.004G021000.1Potri.011G077400.1Potri.T112400.1Potri.018G084300.1
Potri.006G160700.1Potri.011G025800.1Potri.003G159700.2
Prunus persicappa009472mppa009387mppa009863mppa009346mppa009871m
ppa020825mppa009608mppa009417mppa009792mppa009610m
ppa009350mppa017487mppa009685mppa015713mppa021675m
ppa026319mppa009365mppa021295mppa009245mppa010231m
Ricinus communis30131.m00693330128.m00859129615.m00048930179.m00057330065.m001165
30179.m00057429993.m00105529993.m00105629912.m00547627632.m000165
30179.m00056929693.m00209529693.m00209430099.m00166329842.m003641
Setaria italicaSi010796mSi026698mSi007018mSi006992mSi006487m
Si008187mSi010315mSi015709mSi030570mSi017963m
Si017966mSi007010mSi012626mSi015388mSi015312m
Si015667mSi010702mSi010719mSi014188m
Selaginella moellendorffii11041841336398543119243118035
9867497913267868233454140273
42292275136
Sorghum bicolorSb06g027670.1Sb05g020400.1Sb10g028550.1Sb10g028580.1Sb07g007010.1
Sb10g028570.1Sb10g028560.1Sb01g015620.1Sb06g029660.1Sb07g007460.1
Sb02g035160.1Sb04g010980.1Sb04g010760.1Sb10g019390.1Sb07g007020.1
Sb06g027680.1Sb06g027660.1Sb07g007450.1
Thellungiella halophilaThhalv10025884mThhalv10014262mThhalv10004708mThhalv10002626mThhalv10028859m
Thhalv10025705mThhalv10025941mThhalv10014301mThhalv10025720mThhalv10014326m
Thhalv10022791mThhalv10023177mThhalv10014316mThhalv10025909mThhalv10025933m
Thhalv10025803mThhalv10025892mThhalv10025934mThhalv10008296m
Vitis viniferaGSVIVT01000416001GSVIVT01029174001GSVIVT01029162001GSVIVT01029372001GSVIVT01001124001
GSVIVT01015345001.672.840GSVIVT01037018001GSVIVT01029172001GSVIVT01012635001GSVIVT01029163001
GSVIVT01029161001GSVIVT01029160001GSVIVT01029173001GSVIVT01029158001GSVIVT01029167001
GSVIVT01029175001GSVIVT01029166001GSVIVT01029165001GSVIVT01029171001GSVIVT01021359001
GSVIVT01021354001GSVIVT01031578001GSVIVT01031601001GSVIVT01031593001GSVIVT01029170001
Zea maysAC210669.3_FGT001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)