y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G083600.3
FamilyCE16
Protein PropertiesLength: 297 Molecular Weight: 32869.1 Isoelectric Point: 6.0761
ChromosomeChromosome/Scaffold: 04 Start: 10310126 End: 10311395
DescriptionGDSL-like Lipase/Acylhydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1692784.2e-23
  YLESVGSPSFQTGCNFATGGSTILPANAASTNPFSFNLQLSQFFRFKNRALTLLSKDKELQNYLPAEDDFNKALYIFDIGQNDLDRVFYFPVSDEQVVAF
  ISKLMSELNYGMKRLYDAGARNFWVHNTGPLGCLPRIIATFGKKPSNLDEHGCVASHNRAATVFNKKLHDMCLQFLAHSPEANITYVDIFSIKLNLISNY
  SLYGFQHPLAACCGYGGPPLNFDTRIACGVTKDLNGSIVTANPCNNTAEYINWDGTHYTEAANGFVADEI
Full Sequence
Protein Sequence     Length: 297     Download
MELPYMNPYL ESVGSPSFQT GCNFATGGST ILPANAASTN PFSFNLQLSQ FFRFKNRALT    60
LLSKDKELQN YLPAEDDFNK ALYIFDIGQN DLDRVFYFPV SDEQVVAFIS KLMSELNYGM    120
KRLYDAGARN FWVHNTGPLG CLPRIIATFG KKPSNLDEHG CVASHNRAAT VFNKKLHDMC    180
LQFLAHSPEA NITYVDIFSI KLNLISNYSL YGFQHPLAAC CGYGGPPLNF DTRIACGVTK    240
DLNGSIVTAN PCNNTAEYIN WDGTHYTEAA NGFVADEILT GNYSDSPHLR NSPFLT*       300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01847Triacylglycerol_lipase_like7.0e-145229230+
pfam00657Lipase_GDSL8.0e-1761278224+
cd01846fatty_acyltransferase_like2.0e-1714279266+
PLN03156PLN031566.0e-224279284+
cd01837SGNH_plant_lipase_like9.0e-801282284+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI32324.10128782367unnamed protein product [Vitis vinifera]
RefSeqXP_002271470.10128782367PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301566.10129673368predicted protein [Populus trichocarpa]
RefSeqXP_002512338.10129582375Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
RefSeqXP_002524808.101287120405Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AI726006237312670
CO08752221612160
DT54749521412140
DT54714217911790
AI726006282692960.03
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00316.1Aquca_003_00419.2Aquca_026_00042.1Aquca_003_00426.1Aquca_081_00039.1
Aquca_037_00027.1Aquca_056_00007.2Aquca_056_00007.1Aquca_011_00355.1Aquca_040_00030.1
Aquca_037_00028.1Aquca_040_00028.1Aquca_056_00007.4Aquca_056_00007.3Aquca_026_00039.1
Arabidopsis lyrata474829334218864389474754485206
909410
Arabidopsis thalianaAT1G54790.3AT1G56670.1AT1G09390.1AT1G54790.1AT4G01130.1
AT3G48460.1AT1G54790.2AT5G14450.1
Brachypodium distachyonBradi2g25920.4Bradi2g25920.1Bradi2g45280.1
Brassica rapaBra020025Bra038972Bra019545Bra018056Bra040640
Bra030108Bra008757Bra039455Bra027918
Carica papayaevm.model.supercontig_184.1evm.model.supercontig_4.64
Capsella rubellaCarubv10020428mCarubv10001068mCarubv10011694mCarubv10020463mCarubv10017363m
Carubv10003515m
Citrus clementinaCiclev10020570mCiclev10000365mCiclev10023404m
Citrus sinensisorange1.1g017185morange1.1g016679morange1.1g017691morange1.1g018055morange1.1g016356m
Cucumis sativusCucsa.091760.1Cucsa.090420.1Cucsa.340130.1Cucsa.135890.1
Eucalyptus grandisEucgr.H01304.1Eucgr.B03271.1Eucgr.H02485.1Eucgr.D02341.2Eucgr.D02341.1
Fragaria vescamrna09914.1-v1.0-hybridmrna00284.1-v1.0-hybridmrna18929.1-v1.0-hybridmrna27870.1-v1.0-hybridmrna22302.1-v1.0-hybrid
Glycine maxGlyma16g03210.1Glyma07g06640.2Glyma07g06640.1Glyma17g18170.2Glyma03g40021.1
Glyma19g42560.2Glyma17g18170.1Glyma03g41580.1Glyma10g29820.1Glyma17g13600.1
Glyma03g40021.2Glyma05g02950.1Glyma19g42560.1Glyma16g07450.1Glyma08g13990.1
Glyma03g38890.1Glyma19g29810.1Glyma19g41470.1
Gossypium raimondiiGorai.007G294300.2Gorai.004G083600.1Gorai.005G176800.1Gorai.007G105000.1Gorai.011G094400.2
Gorai.011G094400.1Gorai.008G204600.1Gorai.007G294300.1Gorai.011G094300.1Gorai.004G083600.2
Linum usitatissimumLus10029980Lus10029639Lus10012644Lus10029638Lus10034763
Malus domesticaMDP0000764366MDP0000312022MDP0000263077MDP0000242118MDP0000134380
Manihot esculentacassava4.1_009552mcassava4.1_010326mcassava4.1_010282mcassava4.1_009992m
Medicago truncatulaMedtr7g113860.1AC233577_14.1Medtr6g007090.1Medtr7g116870.1Medtr4g104240.1
Medtr1g030220.1Medtr7g111780.1
Mimulus guttatusmgv11b006860mmgv11b006645mmgv1a008086mmgv1a008044mmgv1a021460m
Oryza sativaLOC_Os10g25340.1LOC_Os05g33270.1LOC_Os03g62740.1LOC_Os05g04240.1LOC_Os06g06520.1
Panicum virgatumPavirv00029923m
Physcomitrella patensPp1s518_11V6.1
Phaseolus vulgarisPhvul.010G108700.1Phvul.006G094100.1Phvul.003G239200.1Phvul.007G182500.1Phvul.008G155800.1
Phvul.003G208000.1Phvul.001G223500.1
Picea abiesMA_9754208g0010MA_5197g0010MA_114950g0010MA_5042g0010MA_10331604g0010
MA_75971g0010MA_10433283g0020
Populus trichocarpaPotri.013G015200.1Potri.005G038800.1Potri.015G089700.1Potri.002G216000.1Potri.014G094100.1
Potri.005G038800.2Potri.005G006500.1Potri.005G006500.2
Prunus persicappa023404mppa017417mppa001667mppa016576mppa007674m
ppa007486mppa007411mppa017062m
Ricinus communis29703.m00154730147.m01380930076.m00459730128.m00895130174.m008697
Setaria italicaSi001849mSi001792mSi004937mSi030054mSi030025m
Si008678mSi024357mSi022330m
Selaginella moellendorffii115333123499410344441488410418
15238152494115316542865258
80611709886583334430
Sorghum bicolorSb03g029650.1Sb01g001540.1Sb10g004120.1Sb02g037820.1Sb09g019710.1
Thellungiella halophilaThhalv10023524mThhalv10023535mThhalv10007968mThhalv10028725mThhalv10010448m
Thhalv10013537mThhalv10020927m
Vitis viniferaGSVIVT01000007001GSVIVT01027038001
Zea maysAC212068.4_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)