y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G092500.1
FamilyGT48
Protein PropertiesLength: 1951 Molecular Weight: 225796 Isoelectric Point: 9.442
ChromosomeChromosome/Scaffold: 04 Start: 13038318 End: 13059817
Descriptionglucan synthase-like 12
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48105318050
  VPSNIDARRRISFFSNSLFMDMPAAPKVRNMLSFSVLTPYYTEEVLFSLQELEEPNEDGVSILFYLQKIFPDEWNNFLERVERNNEEELKESPELQEKLR
  LWASYRGQTLTRTVRGMMYYREALELQAFLDMAKHEDLMEGYKAIELNTEDSKENRSLKAQCEAVADMKFTYVVSCQQYGIQKRSGSERAQDILRLMTKY
  PSLRVAYIDEIEQRSEDRSKKLNGKVNYFSVLVRAVPKSIDSSEQNLDQEIYRIKLPGPAILGEGKPENQNHAIIFTRGEGLQTIDMNQDNYMEEALKMR
  NLLQEFLKKHDGVRYPTILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRLLANPLKVRFHYGHPDVFDRLFHLTRGGVSKASKVINLSEDIFAGFNSTL
  REGNVTHHEYIQVGKGRDVGLNQISMFEAKIANGNGEQTLSRDIYRLGHRFDFFRMLSCYFTTVGFYFSTLVTVLTVYVFLYGRLYLVLSGLEQELSQEP
  AIRDNKPLQVALASQSFVQIGFLMALPMLMEIGLERGFRTALSEFILMQLQLAPVFFTFSLGTKTHYYGRTLLHGGAKYRPTGRGFVVFHAKFAENYRLY
  SRSHFVKGIEMMILLIVYQIFGHTYRSTVAYVLITASLWFMVGTWLFAPFLFNPSGFEWQKIVDDWTDWNKWINNRGGIGVPSEKSWESWWEEEQEHLQY
  SGKRGIIAEILLALRFFIYQYGLVYHLHVTRKTKSFLVYGASWLVIVLILFVM
Full Sequence
Protein Sequence     Length: 1951     Download
MSSSRGSDQS QPMRRITRTQ TAGNLGETAF DSEVVPSSLS EIAPILRVAN EVESSNPRVA    60
YLCRFYAFEK AHRLDPTSSG RGVRQFKTAL LQRLERENDP TLQGRVKKSD AREMQSFYQH    120
YYKKYIQALT NAADKADRAQ LTKAYQTANV LFEVLKAVNL TQAIEVDREI LEAQDRVAEQ    180
TQILVPYNIL PLDPDSANQA IMQYPEIQAA VYALRNTRGL PWPSDHKRKK DEDILDWLQE    240
MFGFQKDNVA NQREHLILLL ANVHIRQFPK PDQQPKLDDH ALTEVMKKLF KNYKKWCKYL    300
DRKSSLWLPT IQQEVQQRKL LYMGLYLLIW GEAANLRFMP ECLCYIYHHM AFELYGMLAG    360
NVSPLTGENI QPAYGGEEEA FLKKVVTPIY EVIRREAERS KRGKSKHSQW RNYDDLNEYF    420
WSVDCFRLGW PMRADADFFC LPTEQLVEKN GDNKPPATRD RWVGKVNFVE IRSFWHVFRS    480
FDRMWSFFIL CLQVMIIVAW NGNGQPSSIF TGDVFKKVLS VFITAAILKL GQAVLDVILS    540
WKAQQSMSFH VKLRYILKVV SAAAWVIVLP VTYAYTSDNP SGIARTIQSW FGSASSSPSL    600
FILAVVIYLS PNMLAAILFL FPFVRRFLES SHYKIVMLMM WWSQPRLYVG RGMHESTFSL    660
FKYTMFWVLL IITKLAFSYY IEIKPLVGPT KAIMSVRIRH FQWHEFFPQA RNNIGVVIAL    720
WAPIILVYFM DTQIWYAIFS TLFGGIYGAF RRLGEIRTLG MLRSRFESLP GAFNARLIPG    780
DKSEKKKKGF WLFFSRSFGQ PRSNKEKEAA KFAQLWNKII SSFREEDLIS NKEMNLLLVP    840
YWADRDLDEI QWPPFLLASK IPIALDMAKD SDSRDRELQK RIEADPYMFC AIRECYASFR    900
SIIRFLVEGL REKRVIDDIF SKVDKRIADG SLIKTYRMSA LPSLYDHIVK LIKLLLENKQ    960
DERGQVVLCF QDMLEIVTKD IMADEEFSSL EHGGSGHDGM IDPLHQLFDT KKLDQLFAST    1020
GAIEFPTPVS EAWREKINRL YLLLTTKESA MDVPSNIDAR RRISFFSNSL FMDMPAAPKV    1080
RNMLSFSVLT PYYTEEVLFS LQELEEPNED GVSILFYLQK IFPDEWNNFL ERVERNNEEE    1140
LKESPELQEK LRLWASYRGQ TLTRTVRGMM YYREALELQA FLDMAKHEDL MEGYKAIELN    1200
TEDSKENRSL KAQCEAVADM KFTYVVSCQQ YGIQKRSGSE RAQDILRLMT KYPSLRVAYI    1260
DEIEQRSEDR SKKLNGKVNY FSVLVRAVPK SIDSSEQNLD QEIYRIKLPG PAILGEGKPE    1320
NQNHAIIFTR GEGLQTIDMN QDNYMEEALK MRNLLQEFLK KHDGVRYPTI LGLREHIFTG    1380
SVSSLAWFMS NQETSFVTIG QRLLANPLKV RFHYGHPDVF DRLFHLTRGG VSKASKVINL    1440
SEDIFAGFNS TLREGNVTHH EYIQVGKGRD VGLNQISMFE AKIANGNGEQ TLSRDIYRLG    1500
HRFDFFRMLS CYFTTVGFYF STLVTVLTVY VFLYGRLYLV LSGLEQELSQ EPAIRDNKPL    1560
QVALASQSFV QIGFLMALPM LMEIGLERGF RTALSEFILM QLQLAPVFFT FSLGTKTHYY    1620
GRTLLHGGAK YRPTGRGFVV FHAKFAENYR LYSRSHFVKG IEMMILLIVY QIFGHTYRST    1680
VAYVLITASL WFMVGTWLFA PFLFNPSGFE WQKIVDDWTD WNKWINNRGG IGVPSEKSWE    1740
SWWEEEQEHL QYSGKRGIIA EILLALRFFI YQYGLVYHLH VTRKTKSFLV YGASWLVIVL    1800
ILFVMKTVSV GRRKFSASYQ LVFRLIKGLI FLTFLSILVI LVTLAHMTIQ DIIVCIFIFM    1860
PTGWGMLLIA QALRPVVKKA GFWGSVRTLA RGYEIVMGLL LFTPVAFLAW FPFVSEFQTR    1920
MLFNQAFSRG LQISRILGGH RKDRTSRHKE *                                   1980
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6055.0e-1042156124+
pfam14288FKS1_dom12.0e-59317433118+
pfam02364Glucan_synthase010531811835+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI16456.101195011948unnamed protein product [Vitis vinifera]
Swiss-ProtQ9LXT901195011964CALS3_ARATH RecName: Full=Callose synthase 3; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 12
RefSeqXP_002283298.101195011947PREDICTED: similar to Callose synthase 3 [Vitis vinifera]
RefSeqXP_002299147.10111950161940predicted protein [Populus trichocarpa]
RefSeqXP_002528124.102195031955transferase, transferring glycosyl groups, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lxm_A0.0044615521128B Chain B, Lip5-chmp5
PDB2lxl_A0.0064615521128A Chain A, Lip5(mit)2
Transmembrane Domains
StartEnd
485504
519541
553575
602624
659681
707729
734751
15121534
15601582
15971614
16811703
17591781
17881805
18201842
18551877
18921914
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7836344774178910
HO780496341137517150
HO780496135124213740
HO780496204170219040
HO783634528549040.000009
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1Gorai.009G169700.3
Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2Gorai.012G187400.1
Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1Gorai.005G042700.1
Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)