y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G093200.3
FamilyAA2
Protein PropertiesLength: 320 Molecular Weight: 34376.5 Isoelectric Point: 4.5028
ChromosomeChromosome/Scaffold: 04 Start: 13708330 End: 13709956
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2441664.3e-33
  AIIRHVLVNASFSDPRIGASLIRLHFHDCFVQGCDASILLDDPVNGEKEAIPNNNSARGYEVIDAMKAALESACPNTVSCADILAIASEQSVSTLAGGPS
  WAVPLGRRDGFTANRTLANSNLP
Full Sequence
Protein Sequence     Length: 320     Download
MPEKMACFQY IVAALCFAVL LEGSLSKAQL TPTFYDETCP NVTAIIRHVL VNASFSDPRI    60
GASLIRLHFH DCFVQGCDAS ILLDDPVNGE KEAIPNNNSA RGYEVIDAMK AALESACPNT    120
VSCADILAIA SEQSVSTLAG GPSWAVPLGR RDGFTANRTL ANSNLPGAHT FGRAQCLTFT    180
SRLYNFTGVG DTDPTLNTTY LEELRQICPQ GGNSSVLTNL DPTTPDGFDN NYFTNLQVNR    240
GLLRSDQNLF STEGADTIEI VNRFSSNQTA FFESFVESMI RMGNISPLTG TEGEIRSNCR    300
AVNSATIRSN SDAALVSSI*                                                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase0.001121282199+
cd00314plant_peroxidase_like2.0e-2746284269+
pfam00141peroxidase1.0e-5146267222+
PLN03030PLN030301.0e-738303328+
cd00693secretory_peroxidase1.0e-15329302303+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PIR02931930347UP10_LACSN Unknown protein 10 from 2D-PAGE
GenBankAAL92037.1013191347AF488305_1 apoplastic anionic gaiacol peroxidase [Gossypium hirsutum]
GenBankABK94318.101131918354unknown [Populus trichocarpa]
EMBLCAA66037.10113199345peroxidase [Populus trichocarpa]
RefSeqXP_002304885.102931930349predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0293052306A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1pa2_A0293052306A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1fhf_C0293031303A Chain A, The Structure Of Soybean Peroxidase
PDB1fhf_B0293031303A Chain A, The Structure Of Soybean Peroxidase
PDB1fhf_A0293031303A Chain A, The Structure Of Soybean Peroxidase
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR925019276733200
GR929709291473090
GR92547725512270
ES831865253642880
ES831865352863200.000000002
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_119.101
Cucumis sativusCucsa.153410.2Cucsa.153460.1
Manihot esculentacassava4.1_015974m
Oryza sativaLOC_Os10g02040.2LOC_Os10g01760.1
Panicum virgatumPavirv00002243m
Populus trichocarpaPotri.001G011000.4Potri.001G011000.3Potri.001G011000.2
Setaria italicaSi039012m
Vitis viniferaGSVIVT01025374001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny