y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G101100.1
FamilyGT1
Protein PropertiesLength: 456 Molecular Weight: 50564 Isoelectric Point: 7.9838
ChromosomeChromosome/Scaffold: 04 Start: 18375650 End: 18378277
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11684202.5e-36
  LDKPLDFLQGFASIRVADLPDGVVRGNFDASVPVLLNKMGLTLPRAAAVAANSYEDLDNAVVNMLKSRYKRFLNVGPSNLMSSSPFDDRHGCLDWLERHQ
  PLSVVYISFGSVITPPPHEIEALTQVLEESNFPFLWSFRGDVEKQLPPGFPKRTSSKGKLVPWAPQQKILEHPSVGVFVSHGGWNSILESISGGVPMVFR
  PFFGDQKLNTRTVEAIWGFGLGLEGGTLTKEATTNALNFILSTEEGKKMRQKV
Full Sequence
Protein Sequence     Length: 456     Download
MEKYKKASKH IAVLAFPFGT HAAPLLSIIR RLSEASPASM FSFLCTERSN SLTFPKGHQK    60
HDSIKPFNVW DGLPEGYTHC LKRNPHEPVD YFLKAVPQNF KDAVEALVAE TGRPIDCLIT    120
DAFYYFGADI ADELKVPWVA LWTASPRALF SHAETEFFRR HVGINDPLDK PLDFLQGFAS    180
IRVADLPDGV VRGNFDASVP VLLNKMGLTL PRAAAVAANS YEDLDNAVVN MLKSRYKRFL    240
NVGPSNLMSS SPFDDRHGCL DWLERHQPLS VVYISFGSVI TPPPHEIEAL TQVLEESNFP    300
FLWSFRGDVE KQLPPGFPKR TSSKGKLVPW APQQKILEHP SVGVFVSHGG WNSILESISG    360
GVPMVFRPFF GDQKLNTRTV EAIWGFGLGL EGGTLTKEAT TNALNFILST EEGKKMRQKV    420
GVQKELAYKA VQPNGSSIEN FKTLVGVVTC HHYLP*                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02448PLN024487.0e-378449476+
PLN02555PLN025556.0e-3710445493+
PLN02173PLN021734.0e-375448482+
pfam00201UDPGT9.0e-3913386413+
PLN02410PLN024102.0e-451445461+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACH56523.2014481444flavonoid 3-glucosyltransferase [Gossypium hirsutum]
DDBJBAE72453.101045216457UDP-glucose: flavonol 3-O-glucosyltransferase [Rosa hybrid cultivar]
RefSeqXP_002319914.1084482448UDP-glucose:flavonoid 3-o-glucosyltransferase [Populus trichocarpa]
RefSeqXP_002325073.1014491448predicted protein [Populus trichocarpa]
RefSeqXP_002533888.10844911453UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hbj_A01044915453A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB3hbf_A01044915453A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c9z_A0104499451A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c1z_A0104499451A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c1x_A0104499451A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES80870237813750
CO0709982821384170
ES80636631613130
DT56667926912670
DW2316312482044490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1Gorai.010G063400.1
Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)