y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G133700.1
FamilyCBM49
Protein PropertiesLength: 629 Molecular Weight: 69543.8 Isoelectric Point: 9.2808
ChromosomeChromosome/Scaffold: 04 Start: 36626402 End: 36631042
Descriptionglycosyl hydrolase 9C2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495366135.19999e-40
  ITIEQKMTTSWNAKGKTYYRYSTIVTNKSYKTLKDLKLSISKLYGPLWGLSKSGNSYGFPTWLNSLPAGKSIEFVYIH
GH9294900
  DYNQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLPMAFTITMMSWSIIEYGKQMGANGELGHAMEAVKWGTDYL
  IKAHPEPYVLYGEVGDGNSDHYCWQRPEDMTTNRHAYKIDPSNPGSDLAGETAAAMAAASIVFRRSNPAYSTELLRHAHQLFEFADKYRGKYDSSITVAQ
  KYYRSISGYNDELLWAAAWLYQASNNEYYLNYLGKNGDSMGGTGWAMTEFGWDVKYAGVQTLVAKFLMQGKAGLHAPVFERYHQKAEYFMCSLIGKGGRN
  IQKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLASSRGSLKCAAVNVAPSELLSFAKSQVDYILGDNPRATSYMVGYGNNFPRQVHHRASSIVSFKVDP
  KFVACRQGYATWYSRKASDPNVLTGAIVGGPDAYDNFADERDNYEQTEPATYNNAPLLGILA
Full Sequence
Protein Sequence     Length: 629     Download
MYMEKLMRLI EMTPLLLLLF LPSAFAGHDY NQALSKSILF FEAQRSGYLP HNQRVTWRAN    60
SGLNDGKASG VDLVGGYYDA GDNVKFGLPM AFTITMMSWS IIEYGKQMGA NGELGHAMEA    120
VKWGTDYLIK AHPEPYVLYG EVGDGNSDHY CWQRPEDMTT NRHAYKIDPS NPGSDLAGET    180
AAAMAAASIV FRRSNPAYST ELLRHAHQLF EFADKYRGKY DSSITVAQKY YRSISGYNDE    240
LLWAAAWLYQ ASNNEYYLNY LGKNGDSMGG TGWAMTEFGW DVKYAGVQTL VAKFLMQGKA    300
GLHAPVFERY HQKAEYFMCS LIGKGGRNIQ KTPGGLIFRQ RWNNMQFVTS ASFLATVYSD    360
YLASSRGSLK CAAVNVAPSE LLSFAKSQVD YILGDNPRAT SYMVGYGNNF PRQVHHRASS    420
IVSFKVDPKF VACRQGYATW YSRKASDPNV LTGAIVGGPD AYDNFADERD NYEQTEPATY    480
NNAPLLGILA RLGGAHGGYN QLLPVVVPAP NPVVAKPKPA PKPKFTPTPA TSSNPITIEQ    540
KMTTSWNAKG KTYYRYSTIV TNKSYKTLKD LKLSISKLYG PLWGLSKSGN SYGFPTWLNS    600
LPAGKSIEFV YIHSTSPADV SVSSYNLA*                                      660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN0217103628629+
PLN02340PLN02340024626606+
PLN02420PLN02420026492469+
PLN00119PLN00119029492464+
pfam00759Glyco_hydro_9029490464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN04496.2036281620endo-1,4-beta-glucanase [Gossypium hirsutum]
EMBLCAI68020.1036281620endo-beta-1,4-glucanase [Prunus persica]
RefSeqXP_002270880.1036281629PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299478.1036281622predicted protein [Populus trichocarpa]
RefSeqXP_002303645.1036271621glycosyl hydrolase family 9 [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0284923428A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1ksc_A0284923428A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1ks8_A0284923428A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A02249218459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0295645487B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO783495378324090
ES821522357323860
CO1277432801364150
CO0721862752295030
CK2492962981264230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)