y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G154200.3
FamilyGT77
Protein PropertiesLength: 230 Molecular Weight: 25813.9 Isoelectric Point: 8.7532
ChromosomeChromosome/Scaffold: 04 Start: 43882470 End: 43885304
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771222161.1e-29
  EKVLVIAEDYATLYKVNEKWPGHAVLVPPAIDSQTAHKFGSQGFFNFTSRRPQHLLKILELGYNVMYNDVDMVWLRDPFPYLEGNHDVYFTDDMA
Full Sequence
Protein Sequence     Length: 230     Download
MSSFLHQRPI QNPFSNAYPV SPRSSSTSQR PISIFSPTGL IILLSLMVIL GVFVPWSGMP    60
VATFSNSKKA SSSLSKWRDY TLAEAASFVA KNGTLIVCAV SQPYLPFLNN WLISITRQKH    120
QEKVLVIAED YATLYKVNEK WPGHAVLVPP AIDSQTAHKF GSQGFFNFTS RRPQHLLKIL    180
ELGYNVMYND VDMVWLRDPF PYLEGNHDVY FTDDMAAVCM LTLLYVLLC*               240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans7.0e-2511921599+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB61018.10222175293A_IG002N01.8 gene product [Arabidopsis thaliana]
GenBankAAK43874.1022184219AF370497_1 unknown protein [Arabidopsis thaliana]
RefSeqNP_567211.1022184219unknown protein [Arabidopsis thaliana]
RefSeqNP_849279.1022184219unknown protein [Arabidopsis thaliana]
RefSeqXP_002511939.1012181216conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
3254
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV15240221812180
CO099218178452220
FC91279122412210
FC87205322112180
FC88292522112180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brachypodium distachyonBradi2g26850.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g027009morange1.1g021054m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Fragaria vescamrna09360.1-v1.0-hybrid
Glycine maxGlyma08g09360.1
Gossypium raimondiiGorai.004G154200.4Gorai.007G104400.1Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010616mcassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Phaseolus vulgarisPhvul.002G188500.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny