y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G158600.10
FamilyGH14
Protein PropertiesLength: 704 Molecular Weight: 79024.2 Isoelectric Point: 5.7114
ChromosomeChromosome/Scaffold: 04 Start: 44776650 End: 44784041
Descriptionbeta-amylase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH142696860
  YVMLPVRVINMKCELADPDGLLKQLRVLKSINVDGVMVDCWWGIVEAHAPQEYNWNGYQRLFQMVRELKLKLQVVMSFHECGGNVGDDVCIPLPHWVAEI
  GRSNPEIFFTDREGRRNPECLSWGIDKERVLRGRTAVEVYFDYMRSFRVEFDEFFEDGIISMVEVGLGPCGELRYPSCPVKHGWRYPGIGEFQCYDQYML
  KSLRKAAEMRGHSFWARGPDNAGSYNSQPHETGFFCDGGGYDGYYGRFFLNWYSQVLLNHGDRVLSLAKLAFDGTCITAKLPGIHWWYKAASHAAELTAG
  YYNPCNRDGYTAIATMLQKHGAALSFSCAEHHILEQQDHLREALADPRGLVWQVLNAAWDVSIPIASENAFLCHDRVGYNKILDNVKPVNDPDGRHFSSF
  TYHRLSPLLMERQNFMEF
Full Sequence
Protein Sequence     Length: 704     Download
MATSMQKLVG VSQEDDEEEM EMDVKEEDDE DEENGEKQIA AQMMIGVDEV MPSTSSSDQF    60
QYQPQLQEQV SNQSGGGGAR RSRPLEEKER TKLRERHRRA ITARILAGLR RHGNYNLRVR    120
ADINDVIAAL AREAGWVVLP DGTTFPSRSQ SSPAAGTSAG MTSSSSQMVS QQIPPPPATL    180
QGVSSGYRTT VEYNACRMKG VFMPTPSHYD LSSTAPAQSL GVVADGGEQT ERLPLIAGST    240
QVINDKQIIG LPTKLPERDF AGTPYVPVYV MLPVRVINMK CELADPDGLL KQLRVLKSIN    300
VDGVMVDCWW GIVEAHAPQE YNWNGYQRLF QMVRELKLKL QVVMSFHECG GNVGDDVCIP    360
LPHWVAEIGR SNPEIFFTDR EGRRNPECLS WGIDKERVLR GRTAVEVYFD YMRSFRVEFD    420
EFFEDGIISM VEVGLGPCGE LRYPSCPVKH GWRYPGIGEF QCYDQYMLKS LRKAAEMRGH    480
SFWARGPDNA GSYNSQPHET GFFCDGGGYD GYYGRFFLNW YSQVLLNHGD RVLSLAKLAF    540
DGTCITAKLP GIHWWYKAAS HAAELTAGYY NPCNRDGYTA IATMLQKHGA ALSFSCAEHH    600
ILEQQDHLRE ALADPRGLVW QVLNAAWDVS IPIASENAFL CHDRVGYNKI LDNVKPVNDP    660
DGRHFSSFTY HRLSPLLMER QNFMEFERFV KRMHGEAVLD PQV*                     720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00197PLN001973.0e-134266693435+
PLN02803PLN028032.0e-155266693432+
PLN02905PLN0290501703703+
PLN02705PLN02705075696625+
PLN02801PLN028010265696440+
Gene Ontology
GO TermDescription
GO:0000272polysaccharide catabolic process
GO:0016161beta-amylase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAE99337.1017001682putative beta-amylase [Arabidopsis thaliana]
EMBLCBI40368.10447031657unnamed protein product [Vitis vinifera]
RefSeqNP_182112.2017001682BAM7 (BETA-AMYLASE 7); beta-amylase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002273843.1017031699PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511857.1017034704Beta-amylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1wdr_A026569611444A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism Of Soybean Beta-Amylase
PDB1byd_A026569611444A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism Of Soybean Beta-Amylase
PDB1byc_A026569611444A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism Of Soybean Beta-Amylase
PDB1byb_A026569611444A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism Of Soybean Beta-Amylase
PDB1bya_A026569611444A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With Beta-Maltose And Maltal: Active Site Components And Their Apparent Role In Catalysis
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5872092552825360
JG6383762652765400
HO0644432392544920
EH7649432522464970
DV0211502923516420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00081.1Aquca_053_00137.1Aquca_005_00422.2Aquca_005_00422.1Aquca_013_00058.1
Aquca_005_00321.1Aquca_013_00313.3Aquca_013_00313.1Aquca_013_00313.2Aquca_005_00321.2
Aquca_005_00321.3Aquca_003_00854.1Aquca_005_00321.5Aquca_005_00321.4
Arabidopsis lyrata479940915010493370482158490517
495656346398356484909881317500.202.436
317500.202.436317500.98.200317500.98.200
Arabidopsis thalianaAT3G23920.1AT4G17090.1AT4G15210.1AT4G15210.2AT2G32290.1
AT4G00490.1AT5G55700.1AT2G45880.1AT5G45300.2AT5G45300.1
AT5G55700.2AT5G18670.1
Brachypodium distachyonBradi1g75610.1Bradi3g28210.1Bradi3g33730.1Bradi2g08187.1Bradi1g25447.1
Bradi1g25440.1Bradi1g25440.2Bradi4g38630.1Bradi1g18390.1Bradi3g02800.1
Bradi1g62400.1Bradi2g00824.1.102.296Bradi2g00824.1.102.296Bradi2g00824.1.300.482Bradi2g00824.1.300.482
Brassica rapaBra015025Bra001937Bra012676Bra026230Bra038088
Bra005581Bra037344Bra035586Bra028964Bra004944
Bra021962Bra002178Bra030861.155.384Bra030861.155.384Bra006472.313.564
Bra006472.313.564Bra006472.86.240Bra006472.86.240Bra030861.18.149Bra030861.18.149
Carica papayaevm.model.supercontig_59.40evm.model.supercontig_18.253evm.model.supercontig_18.252evm.model.supercontig_16.112evm.model.supercontig_12.148
evm.model.supercontig_24.44
Capsella rubellaCarubv10013332mCarubv10006488mCarubv10022978mCarubv10022897mCarubv10005077m
Carubv10000631mCarubv10026217mCarubv10000902mCarubv10022771mCarubv10025996m
Carubv10000685m
Chlamydomonas reinhardtiiCre06.g307150.t1.3Cre01.g044100.t1.2.93.373Cre01.g044100.t1.2.93.373g6066.t1.88.353g6066.t1.88.353
g6066.t1.400.544g6066.t1.400.544
Citrus clementinaCiclev10004620mCiclev10019566mCiclev10014929mCiclev10019360mCiclev10019525m
Ciclev10019424mCiclev10019617mCiclev10000501mCiclev10000490mCiclev10004689m
Ciclev10020448mCiclev10020465mCiclev10000805m
Citrus sinensisorange1.1g008030morange1.1g047891morange1.1g017328morange1.1g010067morange1.1g009162m
orange1.1g008542morange1.1g009981morange1.1g037037morange1.1g005811morange1.1g005715m
orange1.1g009121morange1.1g015723morange1.1g015815morange1.1g015809morange1.1g009335m
orange1.1g010415m.114.332orange1.1g010415m.114.332orange1.1g008086m.281.538orange1.1g008086m.281.538orange1.1g012883m
orange1.1g008086m.95.249orange1.1g008086m.95.249orange1.1g010415m.337.480orange1.1g010415m.337.480
Cucumis sativusCucsa.255940.1Cucsa.383110.1Cucsa.321460.1Cucsa.149940.1Cucsa.148270.1
Cucsa.042020.1Cucsa.135490.2Cucsa.135490.1Cucsa.363240.1Cucsa.228750.2
Cucsa.228750.1
Eucalyptus grandisEucgr.E00330.1Eucgr.H02879.1Eucgr.E01023.1Eucgr.A01734.1Eucgr.E00138.1
Eucgr.E00139.2Eucgr.E00139.1Eucgr.H03767.2Eucgr.H03767.1Eucgr.D02573.1
Fragaria vescamrna28316.1-v1.0-hybridmrna10649.1-v1.0-hybridmrna23897.1-v1.0-hybridmrna25108.1-v1.0-hybridmrna19322.1-v1.0-hybrid
mrna19324.1-v1.0-hybridmrna15254.1-v1.0-hybridmrna06720.1-v1.0-hybridmrna25092.1-v1.0-hybridmrna27696.1-v1.0-hybrid
mrna20803.1-v1.0-hybrid
Glycine maxGlyma09g29840.1Glyma16g34360.2Glyma11g04210.1Glyma01g41190.1Glyma05g05750.2
Glyma17g16020.1Glyma12g11130.1Glyma06g45700.1Glyma08g02920.3Glyma05g36640.1
Glyma12g32330.2Glyma13g38110.1Glyma12g32330.1Glyma13g38120.1Glyma18g46630.1
Glyma09g39603.1Glyma13g28630.1Glyma15g10480.1Glyma09g35070.1Glyma01g35500.2
Glyma07g14030.1
Gossypium raimondiiGorai.011G181000.1Gorai.011G180900.1Gorai.006G073600.1Gorai.008G230100.1Gorai.007G030600.1
Gorai.008G230100.2Gorai.008G230100.3Gorai.011G181000.3Gorai.007G349200.2Gorai.007G349200.1
Gorai.005G208900.2Gorai.005G208900.1Gorai.007G099200.1Gorai.006G215100.1Gorai.011G181000.2
Gorai.004G033500.2Gorai.004G033500.1Gorai.007G099100.2Gorai.007G099100.1Gorai.007G099100.5
Gorai.004G033500.3Gorai.004G158600.3Gorai.004G158600.2Gorai.004G158600.1Gorai.007G099100.4
Gorai.004G158600.8Gorai.004G158600.7Gorai.004G158600.11Gorai.004G158600.12Gorai.004G158600.13
Gorai.008G218300.2Gorai.008G218300.1Gorai.011G185700.1Gorai.008G218300.4Gorai.005G057300.3
Gorai.005G057300.2Gorai.008G218300.3Gorai.007G099100.6Gorai.007G099100.3Gorai.005G057300.1
Gorai.004G158600.5Gorai.004G158600.4Gorai.004G158600.14Gorai.004G158600.9Gorai.004G158600.6
Gorai.011G185700.2Gorai.007G099100.8Gorai.007G099100.7
Linum usitatissimumLus10004396Lus10011035Lus10001087Lus10023700Lus10040134
Lus10039701Lus10018491Lus10003005.166.465Lus10003005.166.465Lus10039702
Lus10023698Lus10016615Lus10030392Lus10033976Lus10012804
Lus10035679Lus10022516Lus10018842Lus10004398.264.475Lus10004398.264.475
Lus10037846.133.367Lus10037846.133.367Lus10004398.97.256Lus10004398.97.256Lus10017820
Lus10023699Lus10037846.367.526Lus10037846.367.526Lus10003005.77.166Lus10003005.77.166
Malus domesticaMDP0000193684MDP0000142134MDP0000144491MDP0000397284MDP0000232760
MDP0000223799MDP0000193840MDP0000186321MDP0000276235MDP0000902717
MDP0000152511MDP0000149950MDP0000262498MDP0000320172MDP0000199386
MDP0000196961MDP0000764433MDP0000730308.253.475MDP0000730308.253.475MDP0000206646
MDP0000270321MDP0000730308.93.252MDP0000730308.93.252MDP0000151553MDP0000951028
MDP0000221724MDP0000141800MDP0000252490MDP0000143571MDP0000569713
MDP0000742467.364.473MDP0000742467.364.473MDP0000742467.245.370MDP0000742467.245.370MDP0000156852
Manihot esculentacassava4.1_004345mcassava4.1_004325mcassava4.1_007768mcassava4.1_005562mcassava4.1_022883m
cassava4.1_005532mcassava4.1_034006mcassava4.1_002728mcassava4.1_034364mcassava4.1_005239m
cassava4.1_032401mcassava4.1_027464m
Medicago truncatulaMedtr5g013640.1Medtr5g013620.1Medtr2g089030.1Medtr2g020240.1Medtr5g026210.1
Medtr5g026210.2
Mimulus guttatusmgv1a003946mmgv1a020099mmgv1a005201mmgv1a006126mmgv1a003882m
mgv1a004577mmgv1a010885mmgv1a002519mmgv1a002385mmgv1a019039m
mgv1a021359mmgv1a025115mmgv1a025317m.115.312mgv1a025317m.115.312mgv1a013237m
mgv1a025317m.13.111mgv1a025317m.13.111mgv1a010101m.75.163mgv1a010101m.75.163mgv1a010101m.174.294
mgv1a010101m.174.294
Oryza sativaLOC_Os03g04770.1LOC_Os10g32810.1LOC_Os10g41550.1LOC_Os07g35940.1LOC_Os07g35880.1
LOC_Os01g13550.1LOC_Os09g39570.1LOC_Os02g03690.1LOC_Os07g47120.1LOC_Os03g22790.1
Panicum virgatumPavirv00029549mPavirv00052483mPavirv00001388mPavirv00055805mPavirv00005817m
Pavirv00059428mPavirv00038949mPavirv00029779mPavirv00029778mPavirv00030206m
Pavirv00001675mPavirv00041462mPavirv00049134mPavirv00011808mPavirv00015859m
Pavirv00053609mPavirv00044941m.182.444Pavirv00044941m.182.444Pavirv00066842mPavirv00005512m
Pavirv00056071m.82.381Pavirv00056071m.82.381Pavirv00070697mPavirv00044941m.443.562Pavirv00044941m.443.562
Pavirv00056071m.378.515Pavirv00056071m.378.515
Physcomitrella patensPp1s106_57V6.1Pp1s317_42V6.1Pp1s233_4V6.1Pp1s23_21V6.1Pp1s16_320V6.1
Pp1s121_168V6.1Pp1s9_318V6.6Pp1s9_318V6.5Pp1s9_318V6.4Pp1s9_318V6.3
Pp1s9_318V6.2Pp1s9_318V6.1Pp1s121_168V6.2
Phaseolus vulgarisPhvul.004G143600.1Phvul.003G226900.1Phvul.011G107700.1Phvul.005G112400.1Phvul.002G301200.1
Phvul.008G065600.1Phvul.006G161200.1Phvul.002G123700.1
Picea abiesMA_124514g0010MA_129283g0010MA_3193g0010MA_10432035g0010MA_10432630g0020
MA_21789g0010MA_35466g0010.91.318MA_35466g0010.91.318MA_8617832g0010MA_10436858g0010
MA_9400165g0010MA_10432251g0010MA_119385g0010MA_158054g0010MA_140148g0010
MA_9635863g0010MA_5725043g0010MA_126087g0010MA_35466g0010.318.430MA_35466g0010.318.430
MA_119385g0020MA_436199g0010MA_19374g0030MA_7200737g0010MA_10429945g0010
MA_19374g0020MA_9635863g0020
Populus trichocarpaPotri.010G062900.1Potri.001G148900.3Potri.001G148900.2Potri.001G148900.1Potri.008G174100.2
Potri.008G174100.1Potri.003G085500.1Potri.010G062900.2Potri.003G143500.1Potri.017G040800.3
Potri.017G040800.1Potri.001G087600.1Potri.017G040800.2Potri.014G083800.1Potri.014G083800.3
Potri.017G040800.4Potri.014G083700.1Potri.002G159300.5Potri.002G159300.3Potri.002G159300.1
Potri.002G159300.4Potri.017G040800.5Potri.003G106500.3Potri.003G106500.5Potri.003G106500.2
Potri.003G106500.1Potri.008G204200.1Potri.002G159300.6Potri.003G106500.4Potri.014G083800.2
Potri.002G159300.2Potri.017G040800.6Potri.014G083700.2Potri.008G204200.2Potri.T101200.1
Potri.T101100.1
Prunus persicappa005431mppa003812mppa003539mppa004334mppa006189m
ppa005450mppa002199mppa002957mppa004116mppa019231m
Ricinus communis29904.m00304629822.m00351730156.m00172330174.m00902830174.m009027
29726.m00398629827.m00263629629.m001377
Setaria italicaSi034946mSi035044mSi034983mSi033152mSi029378m
Si000924mSi028957mSi016592mSi032033mSi034947m
Si016622m.223.485Si016622m.223.485Si016622m.485.614Si016622m.485.614
Selaginella moellendorffii145994232533419538
Sorghum bicolorSb01g047500.1Sb01g028700.1Sb01g019850.1Sb02g035600.1Sb02g035590.1
Sb03g000480.1Sb02g012320.1Sb04g002450.1Sb02g042220.1Sb01g035370.1
Sb02g035600.2.13.225Sb02g035600.2.13.225Sb02g035600.3.209.308Sb02g035600.3.209.308Sb02g035600.2.224.323
Sb02g035600.2.224.323
Thellungiella halophilaThhalv10002460mThhalv10024842mThhalv10024989mThhalv10016419mThhalv10028560m
Thhalv10013225mThhalv10001342mThhalv10001222mThhalv10013215m
Vitis viniferaGSVIVT01013272001GSVIVT01030642001GSVIVT01001863001GSVIVT01026922001GSVIVT01014681001
GSVIVT01026920001GSVIVT01036911001GSVIVT01019605001GSVIVT01017808001
Volvox carteriVocar20007787mVocar20012728m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)