y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G166900.2
FamilyGT22
Protein PropertiesLength: 455 Molecular Weight: 52486 Isoelectric Point: 8.9262
ChromosomeChromosome/Scaffold: 04 Start: 46359007 End: 46366813
Descriptionhomolog of asparagine-linked glycosylation 12
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT221083460
  LPKIYSLIIVRLALGCIILSTLRFLRIQVFATTIFRCDIVLLLCPLGLELLLTKSISFWRAFKCCTVTTLLCIGLTVLVDSIMWKRFLWPEFEVFWFNSV
  LNRSSEWGTHSIHWYFTSALPRSLLTAYPLFMLGVLLDRRLLPLVLPALSFVVLYSKLPHKELRFIISSVPIFNLSAAVAASRIYNNRKKSFWKFLNLVM
  LGLLLISLGCTIITFMASYENYPSGRALKELHQIGHLAN
Full Sequence
Protein Sequence     Length: 455     Download
RSNPTFLVLR LFSHQAECAT MASKFLQLYG YDLLLGSIAA FYVLMVPYTK VEESFNIQAM    60
HDILYHRHHL DNYDHLEFPG VVPRTFIGAF LVSIFSSPIV LAVQLLHLPK IYSLIIVRLA    120
LGCIILSTLR FLRIQVFATT IFRCDIVLLL CPLGLELLLT KSISFWRAFK CCTVTTLLCI    180
GLTVLVDSIM WKRFLWPEFE VFWFNSVLNR SSEWGTHSIH WYFTSALPRS LLTAYPLFML    240
GVLLDRRLLP LVLPALSFVV LYSKLPHKEL RFIISSVPIF NLSAAVAASR IYNNRKKSFW    300
KFLNLVMLGL LLISLGCTII TFMASYENYP SGRALKELHQ IGHLANKSNE LWVHIDPFSA    360
MNGISLFCEN EMPWRYSKEE EITLEEFGQR NFTYLINEHR TIDGYKCLFY VNGFSRLRRQ    420
SGFPPIILDK EPKVYIHGNI RNEELMLKPW PGCS*                               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028168.0e-5178279102+
pfam03901Glyco_transf_223.0e-16161298139+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001077446.10234538493transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001077448.10234538497transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001117214.10604531453transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002448266.103245322499hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
RefSeqXP_002526470.109433110592glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2547
86108
115137
163185
302324
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG4646052701754440
ES7912381752624360
ES4360902761324070
EG4923622181753920
EG492362693854530
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.1AT1G02145.2AT1G02145.4AT1G02145.3
Brachypodium distachyonBradi5g17390.1
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Fragaria vescamrna05309.1-v1.0-hybrid
Glycine maxGlyma07g13150.1Glyma03g25680.2Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.4Gorai.004G166900.1Gorai.004G166900.3
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.2Phvul.010G045600.4Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny