y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G166900.3
FamilyGT22
Protein PropertiesLength: 433 Molecular Weight: 49885.2 Isoelectric Point: 9.5029
ChromosomeChromosome/Scaffold: 04 Start: 46359007 End: 46366758
Descriptionhomolog of asparagine-linked glycosylation 12
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2273240
  GAFLVSIFSSPIVLAVQLLHLPKIYSLIIVRLALGCIILSTLRFLRIQVRNKFGHQVEAFFVIFTAIQFHLLFYCSRALPNILAMGVVNLAYGHWLKGNF
  YTALNYLVFATTIFRCDIVLLLCPLGLELLLTKSISFWRAFKCCTVTTLLCIGLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTHSIHWYFTSALP
  RSLLTAYPLFMLGVLLDRRLLPLVLPALSFVVLYSKLPHKELRFIISSVPIFNLSAAVAASRIYNNRKKSFWKFLNLVMLGLLLISLGCTIITFMASYEN
  YPSGRALKELHQIGHLAN
Full Sequence
Protein Sequence     Length: 433     Download
MILFFAGAFL VSIFSSPIVL AVQLLHLPKI YSLIIVRLAL GCIILSTLRF LRIQVRNKFG    60
HQVEAFFVIF TAIQFHLLFY CSRALPNILA MGVVNLAYGH WLKGNFYTAL NYLVFATTIF    120
RCDIVLLLCP LGLELLLTKS ISFWRAFKCC TVTTLLCIGL TVLVDSIMWK RFLWPEFEVF    180
WFNSVLNRSS EWGTHSIHWY FTSALPRSLL TAYPLFMLGV LLDRRLLPLV LPALSFVVLY    240
SKLPHKELRF IISSVPIFNL SAAVAASRIY NNRKKSFWKF LNLVMLGLLL ISLGCTIITF    300
MASYENYPSG RALKELHQIG HLANKSNELW VHIDPFSAMN GISLFCENEM PWRYSKEEEI    360
TLEEFGQRNF TYLINEHRTI DGYKCLFYVN GFSRLRRQSG FPPIILDKEP KVYIHGNIRN    420
EELMLKPWPG CS*                                                       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028169.0e-5156257102+
pfam03901Glyco_transf_221.0e-2213276281+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF59128.10843126449unknown protein [Arabidopsis thaliana]
RefSeqNP_001077446.10843170493transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001077448.10543171497transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001117214.10543127453transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002271419.102643263469PREDICTED: hypothetical protein [Vitis vinifera]
Transmembrane Domains
StartEnd
224
3451
6380
84102
109131
141163
280302
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG492307300253240
EG4646052701534220
EL43554129953030
EG492396269563240
EG4923963425580.0002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.1AT1G02145.2AT1G02145.4AT1G02145.3
Brachypodium distachyonBradi5g17390.1
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Fragaria vescamrna05309.1-v1.0-hybrid
Glycine maxGlyma07g13150.1Glyma03g25680.2Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.2Gorai.004G166900.4Gorai.004G166900.1
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.2Phvul.010G045600.4Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny