y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G170700.3
FamilyGH89
Protein PropertiesLength: 746 Molecular Weight: 84304.1 Isoelectric Point: 6.7878
ChromosomeChromosome/Scaffold: 04 Start: 47025703 End: 47032781
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH891087180
  GPEILIKGTTAVEIASGLHWYIKYFCGAHVSWDKTGGVQLASVPKPGSLPLVKDGGVLIQRPVPWNYYQNVVTSSYSYVWWDWERWEKEIDWMALQGINL
  PLAFSGQEAIWQKVFMGFNISMEDLNDFFGGPAFLAWARMGNLHTWGGPLSKNWLKQQLVLQKKILSRMVELGMTPVLPSFSGNVPAALKTIFPTANITR
  LGDWNTVDGDPHWCCTYLLNPSDPLFVEIGEAFIKMQIKEYGDVTDIYNCDTFNENSPPTNDTIYISSLGAAVYKAMSNGDKDAVWLMQGWLFYSDSTFW
  KPPQMKALLHSVPVGKMIVLDLFADVKPIWATSSQFYGTPYVWCLLHNFGGNIEMYGTLDAISSGPVDARISKNSTMVGVGMCMEGIEQNPVVYELMSEM
  AFRKEKVQVLEWLKTYTHRRYGKSVQQIKEAWAILYHTVYNCTDGIADHNIDFIVKFPDWDPSINFGSRPSKLNSMHTFRLRTRSRRFSFQERSSDLPQA
  HLWYSTHEVVSALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQVYLDAINAFRRKDVKALNIHSQKFIQLIKDIDVLLASDDNFLLGTWLESAKLL
  AENPSEMRQFK
Full Sequence
Protein Sequence     Length: 746     Download
MAVAIIRILN NSPTMKFIIG DVLIIIFILF ITRLPQSFST TEAIQPSLTR LDSKRSSPSV    60
QESAAKAVLG RLLPTHLLSF HFKIVSKDVC GGQGCFLIEN YDGPTENGPE ILIKGTTAVE    120
IASGLHWYIK YFCGAHVSWD KTGGVQLASV PKPGSLPLVK DGGVLIQRPV PWNYYQNVVT    180
SSYSYVWWDW ERWEKEIDWM ALQGINLPLA FSGQEAIWQK VFMGFNISME DLNDFFGGPA    240
FLAWARMGNL HTWGGPLSKN WLKQQLVLQK KILSRMVELG MTPVLPSFSG NVPAALKTIF    300
PTANITRLGD WNTVDGDPHW CCTYLLNPSD PLFVEIGEAF IKMQIKEYGD VTDIYNCDTF    360
NENSPPTNDT IYISSLGAAV YKAMSNGDKD AVWLMQGWLF YSDSTFWKPP QMKALLHSVP    420
VGKMIVLDLF ADVKPIWATS SQFYGTPYVW CLLHNFGGNI EMYGTLDAIS SGPVDARISK    480
NSTMVGVGMC MEGIEQNPVV YELMSEMAFR KEKVQVLEWL KTYTHRRYGK SVQQIKEAWA    540
ILYHTVYNCT DGIADHNIDF IVKFPDWDPS INFGSRPSKL NSMHTFRLRT RSRRFSFQER    600
SSDLPQAHLW YSTHEVVSAL KLFLAAGNDL AGSLTYRYDL VDLTRQVLSK LANQVYLDAI    660
NAFRRKDVKA LNIHSQKFIQ LIKDIDVLLA SDDNFLLGTW LESAKLLAEN PSEMRQFKPL    720
LDFDWNAAEV IFILCDSMNG MLERK*                                         780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12971NAGLU_N1.0e-226115999+
pfam12972NAGLU_C1.0e-61518727210+
pfam05089NAGLU0174513340+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI24942.10472753769unnamed protein product [Vitis vinifera]
GenBankEEE59081.105673751723hypothetical protein OsJ_10898 [Oryza sativa Japonica Group]
RefSeqNP_196873.104873732716alpha-N-acetylglucosaminidase family / NAGLU family [Arabidopsis thaliana]
RefSeqXP_002273084.10237274704PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002314048.103773722717predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A066727175781A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vcb_A066727175781A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vca_A066727175781A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vc9_A066727175781A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A066727198804A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Transmembrane Domains
StartEnd
1332
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7834553263196410
GT6223562732945660
GT6276572712214910
HO783455886507373e-17
HO783455326416720.065
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1Bradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780Gorai.001G078400.1.96.430
Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)