y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G170700.4
FamilyGH89
Protein PropertiesLength: 622 Molecular Weight: 70989.4 Isoelectric Point: 7.6079
ChromosomeChromosome/Scaffold: 04 Start: 47026387 End: 47032809
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH8916170
  MALQGINLPLAFSGQEAIWQKVFMGFNISMEDLNDFFGGPAFLAWARMGNLHTWGGPLSKNWLKQQLVLQKKILSRMVELGMTPVLPSFSGNVPAALKTI
  FPTANITRLGDWNTVDGDPHWCCTYLLNPSDPLFVEIGEAFIKMQIKEYGDVTDIYNCDTFNENSPPTNDTIYISSLGAAVYKAMSNGDKDAVWLMQGWL
  FYSDSTFWKPPQMKALLHSVPVGKMIVLDLFADVKPIWATSSQFYGTPYVWCLLHNFGGNIEMYGTLDAISSGPVDARISKNSTMVGVGMCMEGIEQNPV
  VYELMSEMAFRKEKVQVLEWLKTYTHRRYGKSVQQIKEAWAILYHTVYNCTDGIADHNIDFIVKFPDWDPSINFGSRPSKLNSMHTFRLRTRSRRFSFQE
  RSSDLPQAHLWYSTHEVVSALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQVYLDAINAFRRKDVKALNIHSQKFIQLIKDIDVLLASDDNFLLGT
  WLESAKLLAENPSEMRQYEWNARTQVTMWFDTTPTNQSKLHDYANKFWSGLLEGYYLPRASSYFSYLSKSLEKNESFKLVEWRKQWVSFSNKWQAGLELY
  PVKAQGNFLTIAKALFD
Full Sequence
Protein Sequence     Length: 622     Download
MALQGINLPL AFSGQEAIWQ KVFMGFNISM EDLNDFFGGP AFLAWARMGN LHTWGGPLSK    60
NWLKQQLVLQ KKILSRMVEL GMTPVLPSFS GNVPAALKTI FPTANITRLG DWNTVDGDPH    120
WCCTYLLNPS DPLFVEIGEA FIKMQIKEYG DVTDIYNCDT FNENSPPTND TIYISSLGAA    180
VYKAMSNGDK DAVWLMQGWL FYSDSTFWKP PQMKALLHSV PVGKMIVLDL FADVKPIWAT    240
SSQFYGTPYV WCLLHNFGGN IEMYGTLDAI SSGPVDARIS KNSTMVGVGM CMEGIEQNPV    300
VYELMSEMAF RKEKVQVLEW LKTYTHRRYG KSVQQIKEAW AILYHTVYNC TDGIADHNID    360
FIVKFPDWDP SINFGSRPSK LNSMHTFRLR TRSRRFSFQE RSSDLPQAHL WYSTHEVVSA    420
LKLFLAAGND LAGSLTYRYD LVDLTRQVLS KLANQVYLDA INAFRRKDVK ALNIHSQKFI    480
QLIKDIDVLL ASDDNFLLGT WLESAKLLAE NPSEMRQYEW NARTQVTMWF DTTPTNQSKL    540
HDYANKFWSG LLEGYYLPRA SSYFSYLSKS LEKNESFKLV EWRKQWVSFS NKWQAGLELY    600
PVKAQGNFLT IAKALFDKYL S*                                             660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12972NAGLU_C6.0e-106319619301+
pfam05089NAGLU1.0e-1581314314+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI24942.101621247868unnamed protein product [Vitis vinifera]
GenBankEEC75285.101620196811hypothetical protein OsI_11626 [Oryza sativa Indica Group]
GenBankEEE59081.101621196812hypothetical protein OsJ_10898 [Oryza sativa Japonica Group]
RefSeqXP_002273084.101621182803PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002314048.101620186805predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A02619298877A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vcb_A02619298877A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vca_A02619298877A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vc9_A02619298877A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A02619321900A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7834553261204420
HO7834551484515980
CO0851772793095870
CO1311692803005790
HO783455324424730.062
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1Bradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780Gorai.001G078400.1.96.430
Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)