y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G176200.1
FamilyCE13
Protein PropertiesLength: 434 Molecular Weight: 48226.7 Isoelectric Point: 8.9178
ChromosomeChromosome/Scaffold: 04 Start: 48010223 End: 48014148
DescriptionPectinacetylesterase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE13784140
  VVCLDGSPPAYHFDKGSGAGVDNWIVHMEGGGWCEDVPTCLSRKNTDLGSSKQMVKQFGFSGLLSGQQKSNPDFYNWNRIKVRYCDGSSFTGDAVDRANN
  LFFKGNSIWEFIIADLLAKGMRNAKNAILSGCSAGGLASILHCDRFRALLPASTKVKCISDAGFFLHAQDVSGGKHIEEFYGKVARLHGSVKNLPASCTS
  RMGARPELCFFPQYVVQTMQTPIFFVNSAYDSWQIKNILAPSAADKSKAWKSCKLDLKKCTAAQLKTIQDFRTQFLSALNRAGVVNSPSKGMFIDSCYAH
  CQVGKQIQWSSDSSPVVSNMKIAKAVGDWYYERSPIK
Full Sequence
Protein Sequence     Length: 434     Download
MIIGRLRQWL SLLVCVLAVI LLKSEGASVG ITYLQDAVAK GAGRDLFFFL SMFYYMFMYI    60
IYLRHSFFSF FWFGWWCVVC LDGSPPAYHF DKGSGAGVDN WIVHMEGGGW CEDVPTCLSR    120
KNTDLGSSKQ MVKQFGFSGL LSGQQKSNPD FYNWNRIKVR YCDGSSFTGD AVDRANNLFF    180
KGNSIWEFII ADLLAKGMRN AKNAILSGCS AGGLASILHC DRFRALLPAS TKVKCISDAG    240
FFLHAQDVSG GKHIEEFYGK VARLHGSVKN LPASCTSRMG ARPELCFFPQ YVVQTMQTPI    300
FFVNSAYDSW QIKNILAPSA ADKSKAWKSC KLDLKKCTAA QLKTIQDFRT QFLSALNRAG    360
VVNSPSKGMF IDSCYAHCQV GKQIQWSSDS SPVVSNMKIA KAVGDWYYER SPIKKLDCPY    420
PCNPTCPKVD SDS*                                                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE7.0e-17611415407+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK93778.1064336394unknown [Populus trichocarpa]
GenBankACF05806.1014261386PAE [Litchi chinensis]
RefSeqXP_002303225.1064336394predicted protein [Populus trichocarpa]
RefSeqXP_002328833.1014331394predicted protein [Populus trichocarpa]
RefSeqXP_002519912.10343361452pectin acetylesterase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
931
4663
6890
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES806020351784280
CO0836512941094020
CO1218732891464340
ES8353112801003790
ES790739404174150
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00270.1Aquca_047_00106.1Aquca_009_00049.1Aquca_013_00328.2Aquca_013_00328.3
Aquca_003_00241.1Aquca_029_00002.1Aquca_013_00328.1Aquca_006_00270.2Aquca_029_00002.3
Aquca_009_00049.7Aquca_009_00049.5Aquca_009_00049.9Aquca_009_00049.10Aquca_009_00049.4
Aquca_029_00104.1Aquca_007_00862.1Aquca_009_00049.6Aquca_003_00241.2.52.273Aquca_003_00241.2.52.273
Aquca_009_00049.3Aquca_009_00049.2Aquca_009_00049.11Aquca_009_00049.8Aquca_029_00002.2.64.266
Aquca_029_00002.2.64.266Aquca_003_00035.1Aquca_003_00035.2Aquca_003_00035.4Aquca_003_00035.3
Aquca_003_00036.1Aquca_029_00002.2.264.363Aquca_029_00002.2.264.363Aquca_003_00241.2.270.374Aquca_003_00241.2.270.374
Arabidopsis lyrata492919492921478260494455478262
483863477888489494474842486713
311997907665866320897101.332.432897101.332.432
897101.332.432897101.70.204897101.70.204897101.70.204
Arabidopsis thalianaAT3G62060.1AT4G19420.2AT4G19420.1AT4G19410.2AT4G19410.1
AT3G09405.1AT5G26670.2AT3G09410.1AT5G45280.2AT2G46930.1
AT3G05910.1AT3G09410.3AT1G57590.1AT5G26670.1AT5G23870.3
AT5G23870.2AT5G23870.1AT1G09550.1AT5G45280.1AT3G05910.2
Brachypodium distachyonBradi2g38780.1Bradi1g50397.1Bradi2g62420.1Bradi2g62427.3Bradi2g62427.4
Bradi2g62427.2Bradi1g20270.1Bradi2g62410.1Bradi5g20827.1Bradi3g52600.1
Bradi2g12047.2Bradi2g12057.1Bradi3g52600.3Bradi2g12047.1Bradi3g32865.1.69.220
Bradi3g32865.1.69.220Bradi2g62427.1.167.266Bradi2g62427.1.167.266Bradi3g32865.1.224.369Bradi3g32865.1.224.369
Brassica rapaBra004494Bra013395Bra014412Bra020962Bra021961
Bra013394Bra018805Bra029767Bra034069Bra001307
Bra036587Bra020963Bra020800Bra001172Bra009909
Bra009711Bra007657Bra027913Bra030784Bra029386
Bra002014.52.273Bra002014.52.273Bra020015Bra002014.274.374Bra002014.274.374
Carica papayaevm.model.supercontig_920.1evm.model.supercontig_107.67evm.model.supercontig_143.4evm.model.supercontig_143.7evm.model.supercontig_48.227
evm.model.supercontig_57.34evm.model.supercontig_228.11
Capsella rubellaCarubv10005004mCarubv10005284mCarubv10026563mCarubv10013780mCarubv10001019m
Carubv10013814mCarubv10023292mCarubv10017332mCarubv10001048mCarubv10020343m
Carubv10011324mCarubv10020590m
Citrus clementinaCiclev10005117mCiclev10005115mCiclev10012308mCiclev10028674mCiclev10011805m
Ciclev10011803mCiclev10011802mCiclev10020385mCiclev10001467mCiclev10001426m
Ciclev10001371mCiclev10028934mCiclev10030247mCiclev10021084m
Citrus sinensisorange1.1g015995morange1.1g015955morange1.1g022081morange1.1g022038morange1.1g014476m
orange1.1g014431morange1.1g015266morange1.1g016608morange1.1g016602morange1.1g017379m
orange1.1g015845morange1.1g013734morange1.1g014548morange1.1g020895morange1.1g020893m
orange1.1g020755morange1.1g020598morange1.1g020584morange1.1g022338morange1.1g020823m
orange1.1g021817morange1.1g020169morange1.1g017366m.26.245orange1.1g017366m.26.245orange1.1g024695m
orange1.1g024663morange1.1g026241morange1.1g025935morange1.1g035542morange1.1g025752m
orange1.1g017366m.248.348orange1.1g017366m.248.348
Cucumis sativusCucsa.051040.3Cucsa.051040.2Cucsa.228720.4Cucsa.228720.3Cucsa.228720.2
Cucsa.228720.1Cucsa.051040.1Cucsa.107870.1Cucsa.107870.8Cucsa.107870.9
Cucsa.107870.7Cucsa.066180.1Cucsa.066190.1
Eucalyptus grandisEucgr.E01170.5Eucgr.E01170.2Eucgr.E01170.1Eucgr.E01170.4Eucgr.E01170.3
Eucgr.E01169.5Eucgr.E01169.4Eucgr.E01169.3Eucgr.E01169.2Eucgr.E01169.1
Eucgr.D02577.1Eucgr.E01170.6Eucgr.B01828.1Eucgr.A00994.1Eucgr.H01338.1
Eucgr.A02777.2Eucgr.A02777.1Eucgr.A01665.2Eucgr.A01665.1Eucgr.B01829.1
Eucgr.B02195.1Eucgr.B01829.2Eucgr.H01338.2.153.367Eucgr.H01338.2.153.367Eucgr.H01338.2.57.153
Eucgr.H01338.2.57.153
Fragaria vescamrna27697.1-v1.0-hybridmrna13256.1-v1.0-hybridmrna12396.1-v1.0-hybridmrna27699.1-v1.0-hybridmrna22960.1-v1.0-hybrid.424.772
mrna22960.1-v1.0-hybrid.424.772mrna22960.1-v1.0-hybrid.424.772mrna22960.1-v1.0-hybrid.47.391mrna22960.1-v1.0-hybrid.47.391mrna22960.1-v1.0-hybrid.47.391
mrna18404.1-v1.0-hybridmrna22775.1-v1.0-hybrid.42.210mrna22775.1-v1.0-hybrid.42.210mrna22775.1-v1.0-hybrid.210.356mrna22775.1-v1.0-hybrid.210.356
mrna05084.1-v1.0-hybrid
Glycine maxGlyma01g35480.6Glyma01g35480.5Glyma01g35480.4Glyma01g35480.2Glyma16g17190.6
Glyma16g17190.5Glyma16g17190.1Glyma16g08240.1Glyma09g35050.6Glyma09g35050.5
Glyma09g35050.1Glyma16g17120.1Glyma16g17150.1Glyma09g35050.3Glyma10g37890.2
Glyma16g08230.1Glyma16g08230.3Glyma16g08230.2Glyma13g17740.6Glyma13g17740.5
Glyma18g39570.1Glyma19g41240.1Glyma03g38650.1Glyma18g39570.2Glyma10g28230.1
Glyma19g41030.2Glyma19g41030.1Glyma03g38430.2Glyma03g38430.1Glyma20g22210.1
Glyma13g17740.4Glyma13g17740.3Glyma13g17740.2Glyma17g04770.1Glyma02g00930.1
Glyma10g28230.2Glyma10g27960.1Glyma10g27960.2Glyma20g29930.4Glyma20g29930.3
Glyma16g17120.2Glyma10g27960.3Glyma18g40150.1Glyma13g03730.1
Gossypium raimondiiGorai.004G175900.1Gorai.004G176200.6Gorai.004G176200.5Gorai.004G176200.4Gorai.004G176200.3
Gorai.004G176200.2Gorai.008G276500.2Gorai.008G276500.1Gorai.004G176200.7Gorai.008G276500.4
Gorai.008G276500.3Gorai.013G131600.1Gorai.013G211000.1Gorai.007G118400.2Gorai.007G118400.1
Gorai.013G211000.4Gorai.008G133500.1Gorai.013G131600.3Gorai.013G131600.2Gorai.002G257800.2
Gorai.002G257800.1Gorai.012G103700.3Gorai.012G103700.2Gorai.012G103700.1Gorai.013G131600.4
Gorai.013G211000.3Gorai.008G133500.3Gorai.008G133500.4Gorai.008G133500.2Gorai.013G211000.2
Gorai.012G103700.4Gorai.004G175900.2
Linum usitatissimumLus10034767Lus10033305Lus10033301Lus10037269Lus10035682
Lus10034762Lus10039238Lus10007200Lus10024398Lus10038024
Lus10009966Lus10034766Lus10033304Lus10010084.203.368Lus10010084.203.368
Lus10010084.64.204Lus10010084.64.204Lus10025347.63.150Lus10025347.63.150Lus10000253
Malus domesticaMDP0000756536MDP0000286498MDP0000171708MDP0000834641MDP0000163930
MDP0000202156MDP0000193151MDP0000162976MDP0000200867MDP0000310803
MDP0000243428MDP0000273242MDP0000207848MDP0000171707MDP0000221319.149.411
MDP0000221319.149.411MDP0000188229.149.411MDP0000188229.149.411MDP0000279892MDP0000253085.607.818
MDP0000253085.607.818MDP0000869939MDP0000313863.24.193MDP0000313863.24.193MDP0000248589
MDP0000186817.220.475MDP0000186817.220.475MDP0000275189MDP0000253085.818.916MDP0000253085.818.916
MDP0000186818MDP0000218292MDP0000313863.193.341MDP0000313863.193.341MDP0000258999
MDP0000212077MDP0000186817.99.187MDP0000186817.99.187MDP0000221319.24.113MDP0000221319.24.113
MDP0000188229.24.113MDP0000188229.24.113
Manihot esculentacassava4.1_032614mcassava4.1_008588mcassava4.1_032451mcassava4.1_007245mcassava4.1_024915m
cassava4.1_027434mcassava4.1_009130mcassava4.1_009152mcassava4.1_009149mcassava4.1_008923m
cassava4.1_008511mcassava4.1_029863mcassava4.1_008507mcassava4.1_007275mcassava4.1_011665m
cassava4.1_009564mcassava4.1_028266m
Medicago truncatulaMedtr8g072010.1Medtr8g072000.1Medtr5g042650.1Medtr1g101000.1Medtr1g101020.1
Medtr7g110900.2Medtr7g110900.1Medtr7g060760.1Medtr4g124320.1Medtr7g111280.1
Medtr1g085070.1
Mimulus guttatusmgv1a023759mmgv1a007810mmgv1a007934mmgv1a007782mmgv1a007656m
mgv1a007102mmgv1a007602mmgv1a010619mmgv1a007479mmgv1a007660m
mgv1a008697mmgv1a006907mmgv1a006506mmgv1a007583mmgv1a011392m
mgv1a010255mmgv1a012163mmgv1a021236mmgv1a019134mmgv1a019753m.167.311
mgv1a019753m.167.311mgv1a011422m.129.254mgv1a011422m.129.254mgv1a015116mmgv1a016175m
mgv1a019740m
Oryza sativaLOC_Os05g02120.1LOC_Os02g47400.1LOC_Os01g74330.1LOC_Os02g47400.2LOC_Os01g66840.1
LOC_Os01g66830.1LOC_Os01g66850.1LOC_Os07g44070.2LOC_Os01g21630.1LOC_Os04g51340.1
LOC_Os07g44070.1LOC_Os10g40290.1.74.208LOC_Os10g40290.1.74.208LOC_Os10g40290.1.224.375LOC_Os10g40290.1.224.375
Panicum virgatumPavirv00064077mPavirv00033561mPavirv00064079mPavirv00044124mPavirv00070012m
Pavirv00064080mPavirv00010768mPavirv00036492mPavirv00016312mPavirv00042781m
Pavirv00053749mPavirv00002139mPavirv00015127mPavirv00008793mPavirv00070395m
Pavirv00014133mPavirv00034669mPavirv00069487mPavirv00030753mPavirv00033562m
Pavirv00029888mPavirv00064078mPavirv00064081m.47.270Pavirv00064081m.47.270Pavirv00026712m.209.417
Pavirv00026712m.209.417Pavirv00032744m.210.418Pavirv00032744m.210.418Pavirv00032744m.36.183Pavirv00032744m.36.183
Pavirv00060334m.57.202Pavirv00060334m.57.202Pavirv00026712m.35.182Pavirv00026712m.35.182Pavirv00064081m.267.369
Pavirv00064081m.267.369Pavirv00015223mPavirv00047470m
Physcomitrella patensPp1s136_39V6.2Pp1s136_39V6.1
Phaseolus vulgarisPhvul.003G277600.1Phvul.002G123900.1Phvul.003G277500.2Phvul.003G277500.1Phvul.001G219200.2
Phvul.001G219200.1Phvul.007G206300.1Phvul.001G221400.2Phvul.001G221400.1Phvul.008G101100.1
Phvul.003G124700.2Phvul.007G208200.1Phvul.007G071700.1Phvul.003G124700.1Phvul.008G101100.2
Phvul.010G075200.1
Picea abiesMA_10432685g0010MA_340147g0010MA_3303g0010MA_52077g0010MA_10436630g0010
MA_9497g0010MA_10333321g0010MA_10433002g0010MA_8032g0010MA_10333199g0010.92.192
MA_10333199g0010.92.192MA_10435510g0010MA_10435736g0010MA_6644500g0010MA_10328934g0010
MA_8045151g0010MA_112946g0010
Populus trichocarpaPotri.004G234100.1Potri.015G145400.1Potri.012G142300.1Potri.012G142300.2Potri.012G142300.3
Potri.012G142300.4Potri.005G001500.1Potri.004G233900.4Potri.004G233900.3Potri.004G233900.1
Potri.013G000900.1Potri.003G046200.1Potri.014G110900.1Potri.010G004400.2Potri.003G046200.2
Potri.010G004400.1Potri.004G233900.2Potri.006G084900.2Potri.006G084900.1Potri.005G001500.2
Potri.004G233900.5Potri.006G084900.3Potri.003G046200.3.135.342Potri.003G046200.3.135.342Potri.003G046200.3.25.135
Potri.003G046200.3.25.135Potri.002G185600.1
Prunus persicappa006687mppa006668mppa006446mppa018641mppa006114m
ppa005949mppa006038mppa006718mppa007506mppa007661m
ppa019564m
Ricinus communis29827.m00262830169.m00625330128.m00899129846.m00018929827.m002629
30076.m004531
Setaria italicaSi022068mSi001581mSi005040mSi002381mSi004669m
Si002066mSi029986mSi001489mSi010270mSi001624m
Si001587mSi001540mSi002079mSi017839mSi002101m
Si018011mSi002805mSi035785m.201.409Si035785m.201.409Si035783m.201.409
Si035783m.201.409Si002361mSi035785m.39.182Si035785m.39.182Si035783m.39.182
Si035783m.39.182Si002502m.155.257Si002502m.155.257Si003167m
Selaginella moellendorffii1103354473821186287805883208
27137182014
Sorghum bicolorSb04g030720.1Sb09g001350.1Sb03g013070.2Sb03g047440.1Sb02g040470.1
Sb03g013080.1Sb06g027560.1Sb03g013070.1Sb03g007930.1Sb03g042380.1
Sb01g029710.1Sb03g042400.1.25.136Sb03g042400.1.25.136Sb03g042400.1.170.334Sb03g042400.1.170.334
Thellungiella halophilaThhalv10025385mThhalv10024796mThhalv10020789mThhalv10000914mThhalv10020818m
Thhalv10004301mThhalv10001449mThhalv10004254mThhalv10004253mThhalv10004218m
Thhalv10005997mThhalv10023485mThhalv10029387m
Vitis viniferaGSVIVT01036914001GSVIVT01028921001GSVIVT01034178001GSVIVT01028231001GSVIVT01028230001
GSVIVT01031342001GSVIVT01017717001
Zea maysAC204604.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)