y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G177500.2
FamilyGT77
Protein PropertiesLength: 589 Molecular Weight: 66133.6 Isoelectric Point: 5.2418
ChromosomeChromosome/Scaffold: 04 Start: 48547215 End: 48553067
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771493730
  VSNLLVGAMDTKLLEALYWKGVPVFDMGSHMSTIDVGWGSPTFHKMGREKVLLINAILPFGYELLMCDTDMVWLKDPLPYLAQYPDADILTSSDQVVPTV
  VDDRLADWKQVGAAYNIGIFHWRPTEPAIKLAKEWKDMLLADDKIWDQNGFNELARKQTGPAVDDDSGLFYAFDGTLKLGILPESIFCSGHTYFVQAMYE
  QLRLEPYALHTTFQYGGTEGKRHRL
Full Sequence
Protein Sequence     Length: 589     Download
MGGWRNAVQE AAASKPLFLT IYTTIIVGIV ATSFYVFSAI YSPSAPTSTQ SISTSWLSSP    60
PLSQNGGSNF SNNISQPTDK ASQPGSNQLK TIWEAPPSNS KMPPLESFKL TKELVGERAK    120
DNVIIVTFGN FAFMDFILTW VKHLTDLDVS NLLVGAMDTK LLEALYWKGV PVFDMGSHMS    180
TIDVGWGSPT FHKMGREKVL LINAILPFGY ELLMCDTDMV WLKDPLPYLA QYPDADILTS    240
SDQVVPTVVD DRLADWKQVG AAYNIGIFHW RPTEPAIKLA KEWKDMLLAD DKIWDQNGFN    300
ELARKQTGPA VDDDSGLFYA FDGTLKLGIL PESIFCSGHT YFVQAMYEQL RLEPYALHTT    360
FQYGGTEGKR HRLREAMVFY DPPEYYDAPG GFLSFKPSIP KSLLLDGEHN LESHFSLINY    420
QMKQIRSALA IASLLNRTLV MPPLWCRLDR LWFSHPGVLE GSMTRQPFLC PLDHVFEVNV    480
MLKDLPEEEF GPEINIREYS FLNNPLLPQQ VKESWLDVQL CQEGTEDCHA SSNTSRPGLL    540
RFPKNSTEEM FKTVFSSFKD VKVIQFSSMQ GAFYSFTDKA KRGNSGTV*                600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans1.0e-49149373231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAH19600.1035794589AT2G35610 [Arabidopsis thaliana]
EMBLCBI29197.109057999587unnamed protein product [Vitis vinifera]
RefSeqNP_850250.1035794589unknown protein [Arabidopsis thaliana]
RefSeqXP_002328759.10458115585predicted protein [Populus trichocarpa]
RefSeqXP_002519934.1015841589reticulon3-A3, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR7084012981354320
DT5670462851454290
DT5119933021234240
GR7084052701354040
DT567046284344615.7
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)