y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G177500.8
FamilyGT77
Protein PropertiesLength: 489 Molecular Weight: 56255.3 Isoelectric Point: 5.2261
ChromosomeChromosome/Scaffold: 04 Start: 48548241 End: 48553067
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT7792270
  GAMDTKLLEALYWKGVPVFDMGSHMSTIDVGWGSPTFHKMGREKVLLINAILPFGYELLMCDTDMVWLKDPLPYLAQYPDADILTSSDQVVPTVVDDRLA
  DWKQVGAAYNIGIFHWRPTEPAIKLAKEWKDMLLADDKIWDQNGFNELARKQTGPAVDDDSGLFYAFDGTLKLGILPESIFCSGHTYFVQAMYEQLRLEP
  YALHTTFQYGGTEGKRHRL
Full Sequence
Protein Sequence     Length: 489     Download
MNWNRCDLGA MDTKLLEALY WKGVPVFDMG SHMSTIDVGW GSPTFHKMGR EKVLLINAIL    60
PFGYELLMCD TDMVWLKDPL PYLAQYPDAD ILTSSDQVVP TVVDDRLADW KQVGAAYNIG    120
IFHWRPTEPA IKLAKEWKDM LLADDKIWDQ NGFNELARKQ TGPAVDDDSG LFYAFDGTLK    180
LGILPESIFC SGHTYFVQAM YEQLRLEPYA LHTTFQYGGT EGKRHRLREA MVFYDPPEYY    240
DAPGGFLSFK PSIPKSLLLD GEHNLESHFS LINYQMKQIR SALAIASLLN RTLVMPPLWC    300
RLDRLWFSHP GVLEGSMTRQ PFLCPLDHVF EVNVMLKDLP EEEFGPEINI REYSFLNNPL    360
LPQQVKESWL DVQLCQEGTE DCHASSNTSR PGLLRFPKNS TEEMFKTVFS SFKDVKVIQF    420
SSMQGAFYSF TDKTREGKFR NRMKRYVGIW CCVENHTPGH IYYDMYWDEK PGWKPAPPQT    480
 PEEDHPPF*                                                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans3.0e-469227225+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29197.108488163642unnamed protein product [Vitis vinifera]
RefSeqNP_850250.108488164644unknown protein [Arabidopsis thaliana]
RefSeqXP_002269181.108488232711PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328759.108488158638predicted protein [Populus trichocarpa]
RefSeqXP_002519934.108488160639reticulon3-A3, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR70840127982860
DT56704627682830
EX130872295463400
EV235113303413430
DT567046282883156.7
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)