y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G227300.6
FamilyAA2
Protein PropertiesLength: 126 Molecular Weight: 13665.9 Isoelectric Point: 9.1456
ChromosomeChromosome/Scaffold: 04 Start: 56159922 End: 56160970
Descriptionascorbate peroxidase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2181207.5e-32
  KAKRKLRALIAEKNCAPLMLRLAWHSAGTFDVKTKTGGPFGTMKQPAELAHAANNGLDIAVRLLEPIKEQFPILSYADFYQVAGVVAVEITGGPEIPFHP
  GRV
Full Sequence
Protein Sequence     Length: 126     Download
MTKCYPTVSE EYQNAVQKAK RKLRALIAEK NCAPLMLRLA WHSAGTFDVK TKTGGPFGTM    60
KQPAELAHAA NNGLDIAVRL LEPIKEQFPI LSYADFYQVA GVVAVEITGG PEIPFHPGRV    120
VSLNL*                                                               180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like3.0e-2717125116+
PLN02608PLN026087.0e-596119114+
cd00691ascorbate_peroxidase3.0e-635120117+
PLN02364PLN023647.0e-651119119+
PLN02879PLN028799.0e-711120120+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB82778.1011191119ripening-associated protein [Musa acuminata AAA Group]
GenBankAAC08576.1011191119ascorbate peroxidase [Zantedeschia aethiopica]
GenBankABP87792.1011191119ascorbate peroxidase [Malus x domestica]
RefSeqXP_002322851.1011191119predicted protein [Populus trichocarpa]
RefSeqXP_002326165.1011191119predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1apx_D031192118A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB1apx_C031192118A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB1apx_B031192118A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB1apx_A031192118A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2xj6_A031192118A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO11172212011200
DW51736012611260
EV48181711911190
CO12435212011200
CO09780712011200
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00248.3Aquca_006_00248.2Aquca_046_00020.5Aquca_046_00020.4Aquca_046_00020.3
Aquca_046_00020.2Aquca_026_00111.1Aquca_027_00129.2Aquca_027_00129.1Aquca_046_00020.6
Aquca_006_00248.4Aquca_046_00020.1Aquca_046_00020.8Aquca_046_00020.7Aquca_026_00111.2
Aquca_014_00242.4Aquca_014_00242.3Aquca_014_00242.2Aquca_014_00242.1Aquca_006_00248.1
Aquca_014_00242.5Aquca_046_00020.9Aquca_006_00248.5Aquca_026_00111.3Aquca_020_00110.4
Aquca_020_00110.3Aquca_020_00110.2Aquca_020_00110.1
Arabidopsis lyrata899989491157899988478284491040
470824489749476914913218
Arabidopsis thalianaAT4G35000.1AT3G09640.2AT3G09640.1AT1G07890.8AT1G07890.7
AT1G07890.6AT1G07890.5AT1G07890.4AT1G07890.3AT1G07890.2
AT1G07890.1AT4G35970.1AT4G08390.3AT4G08390.2AT4G08390.1
AT1G77490.1AT4G08390.4AT4G32320.1
Brachypodium distachyonBradi5g03640.1Bradi3g42340.1Bradi5g03640.2Bradi1g65820.2Bradi1g16510.1
Bradi1g65820.3Bradi4g41180.1Bradi3g45700.1Bradi5g10490.3Bradi5g10490.1
Bradi3g40330.1
Brassica rapaBra017686Bra013053Bra018677Bra034076Bra030706
Bra031598Bra015668Bra037859Bra023954
Carica papayaevm.model.supercontig_6.282evm.TU.contig_30593.1evm.model.supercontig_139.46evm.model.supercontig_37.148
Capsella rubellaCarubv10005417mCarubv10016423mCarubv10014296mCarubv10009719mCarubv10014466m
Carubv10007422mCarubv10003730mCarubv10020327mCarubv10007089m
Chlamydomonas reinhardtiig10003.t1Cre02.g087700.t1.2Cre06.g285150.t1.2Cre01.g045700.t1.3
Citrus clementinaCiclev10028990mCiclev10026205mCiclev10029206mCiclev10012554mCiclev10030198m
Ciclev10029440mCiclev10029436mCiclev10001462mCiclev10001194mCiclev10008868m
Ciclev10009330m
Citrus sinensisorange1.1g023103morange1.1g024489morange1.1g026905morange1.1g025588morange1.1g026449m
orange1.1g025646morange1.1g025597morange1.1g025595morange1.1g025582morange1.1g025653m
orange1.1g024904morange1.1g024615morange1.1g029728morange1.1g024998morange1.1g029599m
orange1.1g031296morange1.1g031277morange1.1g028643morange1.1g027606morange1.1g028971m
orange1.1g016584morange1.1g016566morange1.1g016549morange1.1g016327morange1.1g013829m
orange1.1g026971morange1.1g030844morange1.1g029351morange1.1g027112morange1.1g030837m
orange1.1g029095morange1.1g027926morange1.1g019824morange1.1g032420morange1.1g030001m
orange1.1g020115morange1.1g026398m
Cucumis sativusCucsa.370590.5Cucsa.370590.2Cucsa.370590.1Cucsa.043770.1Cucsa.213340.2
Cucsa.213340.1Cucsa.043770.2Cucsa.370590.6Cucsa.051640.1Cucsa.060660.1
Cucsa.162470.1
Eucalyptus grandisEucgr.I01408.1Eucgr.J02463.1Eucgr.B02456.3Eucgr.B02456.2Eucgr.B02456.1
Eucgr.A01180.1Eucgr.J00965.2Eucgr.J00965.1Eucgr.J00965.3Eucgr.B02456.5
Eucgr.F04344.1Eucgr.F04344.2Eucgr.I01408.2Eucgr.B02456.4Eucgr.C01740.1
Eucgr.C01740.2
Fragaria vescamrna14580.1-v1.0-hybridmrna14579.1-v1.0-hybridmrna18099.1-v1.0-hybridmrna25391.1-v1.0-hybridmrna11214.1-v1.0-hybrid
mrna07647.1-v1.0-hybrid.21.142mrna07647.1-v1.0-hybrid.21.142mrna07647.1-v1.0-hybrid.207.314mrna07647.1-v1.0-hybrid.207.314mrna11632.1-v1.0-hybrid
Glycine maxGlyma12g03610.1Glyma11g11460.1Glyma11g08320.1Glyma11g15680.5Glyma12g07780.3
Glyma12g03610.2Glyma01g36940.1Glyma11g15680.3Glyma04g42720.6Glyma04g42720.5
Glyma04g42720.2Glyma04g42720.1Glyma06g12020.1Glyma11g15680.2Glyma06g12020.2
Glyma06g07180.1Glyma06g07180.2Glyma06g12020.5Glyma04g07090.1
Gossypium raimondiiGorai.005G254100.1Gorai.002G196800.1Gorai.003G008200.2Gorai.003G008200.1Gorai.009G420500.1
Gorai.005G254100.4Gorai.004G227100.5Gorai.004G227100.3Gorai.004G227100.2Gorai.004G227100.1
Gorai.004G227200.3Gorai.004G227200.2Gorai.004G227200.1Gorai.002G196800.3Gorai.004G227300.3
Gorai.004G227300.1Gorai.009G104500.4Gorai.009G104500.3Gorai.009G104500.2Gorai.009G104500.1
Gorai.009G104500.5Gorai.013G266100.1Gorai.004G227100.4Gorai.004G227300.4Gorai.009G104500.6
Gorai.005G254100.2Gorai.009G104500.9Gorai.009G104500.8Gorai.009G246900.6Gorai.009G246900.5
Gorai.009G246900.4Gorai.009G246900.2Gorai.009G246900.1Gorai.010G051400.2Gorai.010G051400.1
Gorai.002G196800.2Gorai.004G227300.5Gorai.004G227300.2Gorai.009G104500.10Gorai.009G104500.7
Gorai.005G254100.3.26.133Gorai.005G254100.3.26.133Gorai.009G104500.11Gorai.005G254100.3.134.226Gorai.005G254100.3.134.226
Gorai.009G246900.7Gorai.009G246900.3Gorai.010G115200.3Gorai.010G115200.2Gorai.004G227200.4
Gorai.010G115200.1Gorai.010G115200.7Gorai.010G115200.6Gorai.010G115200.5Gorai.010G115200.4
Gorai.009G246900.8
Linum usitatissimumLus10014128Lus10019781Lus10015970Lus10013537Lus10019906
Lus10000180Lus10025680Lus10028432Lus10018155Lus10002916
Malus domesticaMDP0000151342MDP0000169497MDP0000234905MDP0000210077MDP0000199034
MDP0000241173MDP0000192572MDP0000021998MDP0000126107MDP0000248823
MDP0000399965MDP0000307661MDP0000918790MDP0000261341MDP0000943804
MDP0000254826
Manihot esculentacassava4.1_013189mcassava4.1_013184mcassava4.1_013404mcassava4.1_015356mcassava4.1_024509m
cassava4.1_014642mcassava4.1_014583mcassava4.1_014423mcassava4.1_014643mcassava4.1_013461m
cassava4.1_015710mcassava4.1_015013mcassava4.1_009867mcassava4.1_027175mcassava4.1_028424m
cassava4.1_015058mcassava4.1_031401mcassava4.1_018316mcassava4.1_015741m
Medicago truncatulaMedtr5g022510.1Medtr4g073410.1Medtr4g061140.1Medtr3g088160.3Medtr3g088160.2
Medtr3g088160.1Medtr3g107060.1Medtr5g008440.1
Mimulus guttatusmgv1a011241mmgv1a012445mmgv1a012581mmgv1a012424mmgv1a012401m
mgv1a012399mmgv1a012123mmgv1a008218mmgv1a008194mmgv1a006830m
mgv1a010472m
Oryza sativaLOC_Os04g14680.1LOC_Os08g43560.1LOC_Os03g17690.1LOC_Os08g43560.2LOC_Os07g49400.2
LOC_Os07g49400.1LOC_Os08g43560.3LOC_Os03g17690.2LOC_Os07g49400.3LOC_Os04g35520.4
LOC_Os04g35520.3LOC_Os04g35520.2LOC_Os04g35520.1LOC_Os02g34810.1LOC_Os12g07820.1
LOC_Os12g07830.1LOC_Os07g49400.4LOC_Os08g41090.1
Panicum virgatumPavirv00039524mPavirv00001506mPavirv00010262mPavirv00061650mPavirv00061649m
Pavirv00022559mPavirv00007331mPavirv00049678mPavirv00049677mPavirv00049676m
Pavirv00052189mPavirv00022560mPavirv00061651mPavirv00057923mPavirv00041376m
Pavirv00043064mPavirv00034381mPavirv00019577mPavirv00034191mPavirv00054025m
Pavirv00070703mPavirv00053973mPavirv00065497mPavirv00070704m
Physcomitrella patensPp1s21_105V6.7Pp1s21_105V6.6Pp1s21_105V6.5Pp1s21_105V6.4Pp1s21_105V6.3
Pp1s21_105V6.2Pp1s21_105V6.1Pp1s152_82V6.1Pp1s152_86V6.1Pp1s152_82V6.2
Pp1s152_86V6.2Pp1s424_33V6.1Pp1s277_34V6.1
Phaseolus vulgarisPhvul.011G035000.1Phvul.002G107000.1Phvul.011G071300.1Phvul.011G035000.2Phvul.009G126500.2
Phvul.009G126500.1Phvul.002G104700.1Phvul.009G093000.1
Picea abiesMA_79741g0010MA_110270g0010MA_177059g0010MA_119996g0010MA_20242g0010
MA_22175g0010MA_103975g0010MA_445446g0010MA_23907g0010
Populus trichocarpaPotri.009G134100.4Potri.009G134100.3Potri.009G134100.2Potri.009G134100.1Potri.005G112200.1
Potri.004G174500.1Potri.016G084800.1Potri.009G015400.9Potri.009G015400.8Potri.009G015400.11
Potri.009G015400.10Potri.006G132200.3Potri.016G084800.3Potri.006G132200.2Potri.009G015400.1
Potri.016G084800.5Potri.016G084800.4Potri.016G084800.2Potri.009G015400.2Potri.009G015400.6
Potri.009G015400.5Potri.009G015400.4Potri.006G132200.4Potri.005G179200.6Potri.005G179200.5
Potri.005G179200.4Potri.005G179200.3Potri.005G179200.2Potri.005G179200.1Potri.002G081900.1
Potri.009G015400.7Potri.006G132200.1Potri.009G015400.3Potri.002G081900.2Potri.009G015400.12
Potri.006G254500.1Potri.006G089000.1
Prunus persicappa009538mppa009582mppa010426mppa010431mppa010413m
ppa010673mppa006270mppa015878m
Ricinus communis29602.m00021729781.m00001329648.m00202429656.m00047729848.m004624
29805.m001492
Setaria italicaSi010452mSi014193mSi030912mSi037167mSi014221m
Si031017mSi031192mSi010652mSi010520mSi017077m
Si014042mSi014032m
Selaginella moellendorffii11903913933727017685469156990
74674169019
Sorghum bicolorSb06g001970.1Sb07g024880.1Sb02g044060.1Sb01g038760.1Sb08g004880.1
Sb06g017080.1Sb04g022560.1Sb07g027300.1
Thellungiella halophilaThhalv10025911mThhalv10022797mThhalv10021381mThhalv10025942mThhalv10008573m
Thhalv10023023mThhalv10008402mThhalv10028759mThhalv10018587mThhalv10018581m
Thhalv10025686mThhalv10018732m
Vitis viniferaGSVIVT01024035001GSVIVT01025551001GSVIVT01025104001GSVIVT01018740001GSVIVT01008846001
GSVIVT01035858001GSVIVT01018743001
Volvox carteriVocar20005261mVocar20010884mVocar20010184mVocar20006631mVocar20006630m.86.187
Vocar20006630m.86.187Vocar20006630m.472.696Vocar20006630m.472.696
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)