y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G231200.1
FamilyGH29
Protein PropertiesLength: 521 Molecular Weight: 58296.8 Isoelectric Point: 5.8273
ChromosomeChromosome/Scaffold: 04 Start: 56832477 End: 56835708
Descriptionalpha-L-fucosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH29473450
  ASQLQWQLSSMALFLHFGPNTFTDSEWGTGHASPSVFNPTLLNASQWVHVAKEAGFSRVILTAKHHDGFCLWLSEYTDYSVKASPWRNGKGDVVAELAAG
  AKEAGIALGLYLSPWDRHESCYGKTLEYNEFYIGQMTELLTRYGDIKEVWLDGAKGEGEKDMEYYFDAWFSLIHQLQPDAVIFSDAGPDTRWIGDEAGVA
  GSTCWSLFNRSNAVIGGTNPQYSQGGDPHGHDWVPAECDVSIRPGWFWHASQVPKSALELLDIYYKSTGRNCLLLLNVPPNSSGLISDEDIQALQEFKE
Full Sequence
Protein Sequence     Length: 521     Download
MPNPSFNSRK PISVHALPIF VSLFFSAIPH SALKIPPPLP ILPLPSASQL QWQLSSMALF    60
LHFGPNTFTD SEWGTGHASP SVFNPTLLNA SQWVHVAKEA GFSRVILTAK HHDGFCLWLS    120
EYTDYSVKAS PWRNGKGDVV AELAAGAKEA GIALGLYLSP WDRHESCYGK TLEYNEFYIG    180
QMTELLTRYG DIKEVWLDGA KGEGEKDMEY YFDAWFSLIH QLQPDAVIFS DAGPDTRWIG    240
DEAGVAGSTC WSLFNRSNAV IGGTNPQYSQ GGDPHGHDWV PAECDVSIRP GWFWHASQVP    300
KSALELLDIY YKSTGRNCLL LLNVPPNSSG LISDEDIQAL QEFKELRRSI FSNNLAEKGL    360
LTASSIRGGN DNYQFSPYNV FEESIYTYWA PEEDQRDWVL YLDLQESVSF NVLQVQEPIH    420
MGQRIIKFHL EILSGGRWKN VISGTTVGYK RLLQFPTVQS RYLKLVIDMS RADPLISYMG    480
LHMDRFSILS HASNTTSQIY VNGSQVLRQV PNKDSQTATV *                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart00812Alpha_L_fucos1.0e-3283343288+
pfam01120Alpha_L_fucos1.0e-3283343279+
COG3669COG36694.0e-6651481450+
Gene Ontology
GO TermDescription
GO:0004560alpha-L-fucosidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_180377.203650129493ATFUC1 (alpha-L-fucosidase 1); alpha-L-fucosidase [Arabidopsis thaliana]
Swiss-ProtQ8GW7203650129493FUCO1_ARATH RecName: Full=Alpha-L-fucosidase 1; AltName: Full=Alpha-L-fucoside fucohydrolase; AltName: Full=Alpha-1,3/4-fucosidase; Short=AtFUC1; Flags: Precursor
RefSeqXP_002276131.104650551509PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313533.104648715457predicted protein [Populus trichocarpa]
RefSeqXP_002523703.104651364534alpha-l-fucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ues_B04547719471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3ues_A04547719471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3mo4_B04547721473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3mo4_A04547721473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3uet_B04547719471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis D172aE217A MUTANT COMPLEXED WITH LACTO-N- Fucopentaose Ii
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY270181324103330
DY291901282493300
FC905625316103250
DY27240333873430
DY27793931973250
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00507.1Aquca_062_00017.1
Arabidopsis lyrata481700
Arabidopsis thalianaAT2G28100.1
Brachypodium distachyonBradi4g35500.1Bradi5g18220.1
Brassica rapaBra034388
Carica papayaevm.model.supercontig_65.36evm.model.supercontig_3.250
Capsella rubellaCarubv10023050m
Citrus clementinaCiclev10028463m.194.266Ciclev10004832mCiclev10028210mCiclev10028463m.194.266Ciclev10028463m.51.191
Ciclev10028463m.51.191
Citrus sinensisorange1.1g011170morange1.1g047217m
Cucumis sativusCucsa.385790.1Cucsa.193300.1
Eucalyptus grandisEucgr.J00379.2Eucgr.J00379.1Eucgr.J00367.1Eucgr.A02862.1Eucgr.A02861.1
Fragaria vescamrna13375.1-v1.0-hybridmrna28904.1-v1.0-hybridmrna13376.1-v1.0-hybrid
Glycine maxGlyma12g30151.1Glyma13g39750.2Glyma10g38670.2Glyma20g29080.1Glyma10g38670.1
Gossypium raimondiiGorai.008G282700.1
Linum usitatissimumLus10016140Lus10027390Lus10031681Lus10021427
Malus domesticaMDP0000166406MDP0000271120MDP0000917175MDP0000295518
Manihot esculentacassava4.1_032976mcassava4.1_006636mcassava4.1_007875mcassava4.1_021316m
Medicago truncatulaMedtr1g102230.1Medtr2g095700.1
Mimulus guttatusmgv1a004219mmgv1a005268m
Oryza sativaLOC_Os09g34920.1LOC_Os04g47280.1
Panicum virgatumPavirv00068426mPavirv00016802mPavirv00061161m
Physcomitrella patensPp1s55_131V6.2Pp1s55_131V6.1
Phaseolus vulgarisPhvul.007G063900.1Phvul.005G131200.1
Picea abiesMA_16736g0010MA_171759g0010MA_8122188g0010
Populus trichocarpaPotri.015G133500.1Potri.009G006900.1Potri.012G131400.1
Prunus persicappa023537mppa005337m
Ricinus communis30147.m01415529589.m001240
Setaria italicaSi009874mSi029623m
Selaginella moellendorffii103164236749.37.121236749.37.121415432412246
236951112167158775103375431829
236749.167.333236749.167.333431838103154
Sorghum bicolorSb06g025200.1Sb02g030220.1
Thellungiella halophilaThhalv10016493mThhalv10016468m
Vitis viniferaGSVIVT01018468001.39.381GSVIVT01018468001.39.381GSVIVT01018468001.542.842GSVIVT01018468001.542.842GSVIVT01031495001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)