y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G231500.1
FamilyPL1
Protein PropertiesLength: 379 Molecular Weight: 42175.5 Isoelectric Point: 9.9882
ChromosomeChromosome/Scaffold: 04 Start: 56856358 End: 56857588
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11003000
  WITFKNSMTITLQRPLLLSSFTAIDGRGIDVHITGVGCLLVYQVTDIIIHGLRIHHCKAQPPSTVMGPNAKVIPLGQMDGDAIRLVTARKVWIDHNTLYE
  CQDGLLDVTRGSTNITISNNWFRNQDKVMLLGHDDGHLRDRNMKVTVIFNHFGPNCNQRMPRVRHGYAHVANNFYQGWEQYAIGGSMSPSIKSEANFFVA
  S
Full Sequence
Protein Sequence     Length: 379     Download
MATILSRCLT WALFMVFLMA SFSSSLANMN VIDKCWRGNP FWQSHRQQLA KCSVGFVGKM    60
INNIGKDVVK YKVTDPSDNP LSPKPGTLRY GTTMIKGKVW ITFKNSMTIT LQRPLLLSSF    120
TAIDGRGIDV HITGVGCLLV YQVTDIIIHG LRIHHCKAQP PSTVMGPNAK VIPLGQMDGD    180
AIRLVTARKV WIDHNTLYEC QDGLLDVTRG STNITISNNW FRNQDKVMLL GHDDGHLRDR    240
NMKVTVIFNH FGPNCNQRMP RVRHGYAHVA NNFYQGWEQY AIGGSMSPSI KSEANFFVAS    300
NDVGNKEVTW RKGEKGLWKF YSVGDVFKNG ASFSKQTGVG GAKPNYNREQ DFKVVDAGSV    360
KELTSESGVL RCSRSLTC*                                                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB3.0e-2789297227+
pfam00544Pec_lyase_C2.0e-57119297187+
smart00656Amb_all2.0e-66107301206+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26401.10603781320unnamed protein product [Vitis vinifera]
RefSeqXP_002267384.102437814369PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002299118.10293781354predicted protein [Populus trichocarpa]
RefSeqXP_002304865.10293781352predicted protein [Populus trichocarpa]
RefSeqXP_002527354.1093088307Major pollen allergen Jun v 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0303702345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0303702345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1vbl_A6e-19115326128361A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3zsc_A3e-169329942248A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1jta_A0.000000000000007180301144291A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Transmembrane Domains
StartEnd
931
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR808308257302790
DT5757502251513730
FD7579992131133250
FG606120331253500
HO778688355303790
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.010G196800.1
Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.002G025800.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny