y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G238800.1
FamilyCE8
Protein PropertiesLength: 884 Molecular Weight: 98128.4 Isoelectric Point: 8.5014
ChromosomeChromosome/Scaffold: 04 Start: 57723543 End: 57726707
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE83896840
  LIVAQDGSGDCKTLNEAKQRIPSGSTKPFVIYVKAGVYAENVDFTSDLTHVALVGDGKEKTKITGNISTGPDGKPTTYFTATVGVDGDHFFAKNIAFENS
  AGPLKAQAVALRLQSDFGVFYNCSIDGYQDTLYVFSKRQFFRECTISGTIDFVFGDSAAVFQKCKFLVRKPQLGQQNVVTAQKRLDHNQPTAFVIMDSEI
  IPDAELAPVKNEFPAFLGRPWGKLSRAIIMQTYIDDMVHPEGWTSWDPKEPTNLCQYAEFNNTGPGASTSLRVKWAGVRLLNEAEAINYTPPKFFD
Full Sequence
Protein Sequence     Length: 884     Download
MSSSDDSERK KRIAIIVVSS FLLVAVVVAV TVGVTIQEED SDYDDGTTDG NKHAQVTSSK    60
KAIKMICQPT TFKKTCEEQL QHEAGNKTDV KDLIQAAFKA AMKYVEQAQA NSTLLRDLEK    120
DEGTRSALDA CKILLNSTMR EFNKSLELVD KIEVNTVNKL LGDMKIWLSA TISNQQACLD    180
GFEKTKSKTE AGEKMKKFLN ITMQLSRNGL AIACELSEQL KQLELAGLFE RRRLLQDEDQ    240
LPVVGHSDWT SFLERNKEWN RRRLLQDEDQ LPVVGHSDWT SFLERNKEWN RRRLLQDEDG    300
LPVIGHSDWT SFLERNKEWN RRRLLQDEDG LPVVGHSDWT SFLERNKDWN RRRMLQEGED    360
LSVMGHRDID LEIPAGARRL MSTDLKPDLI VAQDGSGDCK TLNEAKQRIP SGSTKPFVIY    420
VKAGVYAENV DFTSDLTHVA LVGDGKEKTK ITGNISTGPD GKPTTYFTAT VGVDGDHFFA    480
KNIAFENSAG PLKAQAVALR LQSDFGVFYN CSIDGYQDTL YVFSKRQFFR ECTISGTIDF    540
VFGDSAAVFQ KCKFLVRKPQ LGQQNVVTAQ KRLDHNQPTA FVIMDSEIIP DAELAPVKNE    600
FPAFLGRPWG KLSRAIIMQT YIDDMVHPEG WTSWDPKEPT NLCQYAEFNN TGPGASTSLR    660
VKWAGVRLLN EAEAINYTPP KFFDVGDAWI KESGVPYIPD LSIGKAEDKG LIPTSPDVPA    720
SKPENNGFIP TSPDVPASKP ENSGLIPISP DLSASKPENN GVMPISPDLS ASKPENNGVM    780
PVSPDLSASK PENNGVIPIS PDLSASKPEY NGVIPISPNL SASKAAHKGE IKLKKLKHKK    840
KKHHGKGKKH HGKGKKHRGK GKKKGKKSKK HHGKVELKSI TQA*                     900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02990PLN029904.0e-2555242195+
PLN02217PLN022173.0e-415237233+
PLN02217PLN022172.0e-113350791450+
PLN02990PLN029905.0e-114377701327+
pfam01095Pectinesterase2.0e-154388684298+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002318979.17.00005e-4112551251predicted protein [Populus trichocarpa]
RefSeqXP_002318979.10349701223574predicted protein [Populus trichocarpa]
RefSeqXP_002330222.10351702225576predicted protein [Populus trichocarpa]
RefSeqXP_002512459.17.00649e-4512651259Pectinesterase precursor, putative [Ricinus communis]
RefSeqXP_002512459.10352702228580Pectinesterase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A03907016315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A03826972315A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_B1e-2340068119332A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_A1e-2340068119332A Chain A, Pectin Methylesterase From Carrot
PDB2ntp_B1e-2340068119332A Chain A, Pectin Methylesterase From Carrot
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO1039122772665420
CO1291442644437060
EY1975333121584690
EX1655453121584690
CO1039121012083089e-37
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_019_00179.1Aquca_017_00134.1Aquca_017_00135.1Aquca_020_00598.1Aquca_012_00160.1
Aquca_035_00109.1Aquca_035_00108.1Aquca_029_00052.1
Arabidopsis lyrata477851910790494979478002859154
320434353497486726483877
Arabidopsis thalianaAT3G05610.1AT5G27870.1AT5G49180.1AT3G06830.1AT4G15980.1
AT4G33230.1AT2G26450.1AT2G47030.1AT2G47040.1AT3G62170.1
Brachypodium distachyonBradi5g23550.1Bradi4g30980.1Bradi1g64860.1Bradi5g12300.1Bradi1g16780.1
Bradi1g60380.1
Brassica rapaBra039421Bra036610Bra009938Bra040293Bra040532
Bra029607Bra020658Bra038049Bra001219Bra000541
Bra001157Bra037013Bra004481Bra000438Bra040474
Bra007665Bra014410Bra003491
Carica papayaevm.model.supercontig_50.162evm.model.supercontig_48.111evm.model.supercontig_82.46evm.model.supercontig_146.24evm.model.supercontig_41.94
Capsella rubellaCarubv10015948mCarubv10003818mCarubv10027546mCarubv10015933mCarubv10007222m
Carubv10024513mCarubv10006885mCarubv10024512mCarubv10025567mCarubv10019418m
Citrus clementinaCiclev10000446mCiclev10000436mCiclev10000435mCiclev10000415mCiclev10007819m
Ciclev10010665m
Citrus sinensisorange1.1g039111morange1.1g035494m
Cucumis sativusCucsa.159100.1Cucsa.181720.1Cucsa.252880.1Cucsa.069220.1Cucsa.374170.1
Cucsa.374150.1Cucsa.374190.1
Fragaria vescamrna22811.1-v1.0-hybridmrna07045.1-v1.0-hybridmrna07046.1-v1.0-hybridmrna07048.1-v1.0-hybridmrna12964.1-v1.0-hybrid
mrna24568.1-v1.0-hybrid
Glycine maxGlyma15g20460.1Glyma09g08910.2Glyma02g01140.1Glyma10g01180.1Glyma0248s00220.1
Glyma07g02790.1Glyma07g02780.1Glyma07g03010.1Glyma07g02750.1Glyma03g39360.1
Glyma01g27260.1Glyma07g37460.1Glyma17g03170.1Glyma19g41970.1Glyma10g29160.1
Glyma20g38160.3Glyma20g38160.2Glyma09g04730.1Glyma09g04720.1Glyma17g04960.1
Glyma13g17550.1Glyma10g27700.1Glyma03g38230.2Glyma02g01130.1Glyma10g27710.1
Glyma19g40840.1Glyma15g16141.1
Gossypium raimondiiGorai.009G039000.1Gorai.007G340800.1Gorai.007G302000.1Gorai.006G260800.1Gorai.006G260900.1
Gorai.006G260600.1Gorai.006G260700.1Gorai.008G137200.1Gorai.004G146900.1Gorai.013G218500.1
Gorai.007G098400.1Gorai.005G257300.1
Linum usitatissimumLus10006940Lus10015211Lus10031469Lus10018335Lus10037489
Lus10039927Lus10020909Lus10027656Lus10033466Lus10023775
Lus10003968Lus10002976
Malus domesticaMDP0000545023.286.580MDP0000545023.286.580MDP0000267129MDP0000823143MDP0000785852
MDP0000193371MDP0000136674MDP0000200340MDP0000686191MDP0000389664
MDP0000850802MDP0000304455.261.433MDP0000304455.261.433
Manihot esculentacassava4.1_025863mcassava4.1_030825mcassava4.1_027130mcassava4.1_027642mcassava4.1_033112m
cassava4.1_024664mcassava4.1_029816mcassava4.1_029447mcassava4.1_030418mcassava4.1_032868m
Medicago truncatulaMedtr7g112590.1Medtr1g083510.1Medtr1g083500.1Medtr1g083470.1Medtr1g083490.1
Medtr4g005170.1Medtr4g005180.1Medtr1g086190.1Medtr1g086210.1Medtr4g124550.1
Medtr2g044650.1Medtr7g110440.1Medtr7g110510.1Medtr7g110490.1Medtr7g110560.1
Medtr7g110420.1Medtr8g088610.1Medtr5g083620.1Medtr5g083590.1
Mimulus guttatusmgv1a003232mmgv1a003546mmgv1a000814mmgv1a002232mmgv1a003747m
mgv1a003776mmgv1a004121mmgv1a003434mmgv1a003444mmgv1a003726m
mgv1a003697mmgv1a012115mmgv1a027033m
Oryza sativaLOC_Os04g38560.1LOC_Os09g26360.1LOC_Os04g54850.1LOC_Os03g18860.1LOC_Os08g34910.1
LOC_Os03g28090.1LOC_Os07g49100.1
Panicum virgatumPavirv00011682mPavirv00013701mPavirv00057767mPavirv00019846mPavirv00022990m
Pavirv00056855mPavirv00035617mPavirv00014003mPavirv00066510mPavirv00001150m
Phaseolus vulgarisPhvul.007G210400.1Phvul.003G107300.1Phvul.005G015000.1Phvul.005G104100.1Phvul.006G088200.1
Phvul.009G250600.1Phvul.009G222600.1Phvul.007G198100.1Phvul.003G126700.1Phvul.007G198100.2
Phvul.001G217400.1Phvul.001G217300.1Phvul.007G210300.1Phvul.007G210200.1
Populus trichocarpaPotri.018G051200.1Potri.006G134700.1Potri.T030500.1Potri.005G022900.1Potri.013G013400.1
Potri.001G209000.1Potri.003G021600.1Potri.003G021300.1Potri.001G209200.1
Prunus persicappa023802mppa003528mppa026560mppa025631mppa024011m
ppa003441mppa023319mppa003569mppa020185mppa003369m
Ricinus communis29739.m00367629726.m00408330128.m00885829889.m00339630116.m000390
30116.m000389
Setaria italicaSi009724mSi009788mSi015620mSi032329mSi032614m
Si040154m
Sorghum bicolorSb06g018850.1Sb06g030310.1Sb01g037900.1Sb07g022100.1Sb02g025460.1
Sb01g033140.1Sb02g043780.1
Thellungiella halophilaThhalv10003734mThhalv10020314mThhalv10003919mThhalv10020401mThhalv10024582m
Thhalv10024699mThhalv10001934mThhalv10001369mThhalv10005855m
Vitis viniferaGSVIVT01035108001GSVIVT01031165001GSVIVT01017687001GSVIVT01028264001GSVIVT01028265001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)