y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G252800.1
FamilyAA2
Protein PropertiesLength: 315 Molecular Weight: 34227.4 Isoelectric Point: 9.4764
ChromosomeChromosome/Scaffold: 04 Start: 59023476 End: 59024647
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2432960
  RFNTDKSITAALLRMHFHDCFVRGCDASILIDSTNQSRSEKESGPNLTVRGYELIDEAKKALEKVCPSKVSCADIITLATRDSVVLAGGPSYDVPTGRRD
  GRVSNINEVNLPGPSLSVSQAFQSFKDKGLTMDDMVTLLGSHTVGVAHCFFFSGRLTNFQGTGKPDPSMDAGLVTTLKGICGNGSNPTAFLDQGTSFSFD
  NEFYRQIRGKKGVMKIDQELADDRLSSGIVSRFASNANLFRTRFAQAMVKMGNI
Full Sequence
Protein Sequence     Length: 315     Download
MKIIFVLYFT ILLPLALAQL KVGFYKTSCP RAESIVKAAV QKRFNTDKSI TAALLRMHFH    60
DCFVRGCDAS ILIDSTNQSR SEKESGPNLT VRGYELIDEA KKALEKVCPS KVSCADIITL    120
ATRDSVVLAG GPSYDVPTGR RDGRVSNINE VNLPGPSLSV SQAFQSFKDK GLTMDDMVTL    180
LGSHTVGVAH CFFFSGRLTN FQGTGKPDPS MDAGLVTTLK GICGNGSNPT AFLDQGTSFS    240
FDNEFYRQIR GKKGVMKIDQ ELADDRLSSG IVSRFASNAN LFRTRFAQAM VKMGNIQVLV    300
GNAGEIRKNC RVIN*                                                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like2.0e-2334295297+
pfam00141peroxidase2.0e-6836186153+
PLN03030PLN030305.0e-1071314326+
cd00693secretory_peroxidase3.0e-17419313298+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08467.101331413312Haem peroxidase, plant/fungal/bacterial [Medicago truncatula]
GenBankABN08471.102031422311Haem peroxidase, plant/fungal/bacterial [Medicago truncatula]
RefSeqNP_197284.10431410313peroxidase 57 (PER57) (P57) (PRXR10) [Arabidopsis thaliana]
RefSeqXP_002319196.1013145311predicted protein [Populus trichocarpa]
RefSeqXP_002525672.101631417312Peroxidase 44 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0193142304A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB1pa2_A0193142304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3hdl_A0203142303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1gwu_A0193142306A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly
PDB3atj_B0193142306A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR92465225412540
EX66693728592900
FQ35107526012600
GE47835326062620
DR057895262202760
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_028_00270.1
Arabidopsis lyrata488648489264483456913963354185
477612489097
Arabidopsis thalianaAT5G22410.1AT5G17820.1AT2G43480.1AT5G24070.1AT3G03670.1
AT4G26010.1AT1G34510.1
Brachypodium distachyonBradi3g33780.1Bradi3g10460.1Bradi3g10470.1
Brassica rapaBra006423Bra023639Bra036445Bra037713Bra009728
Bra026470Bra019132Bra013943Bra001084Bra019131
Bra020191
Carica papayaevm.model.supercontig_161.43evm.model.supercontig_1040.1evm.model.supercontig_13.208evm.model.supercontig_195.9
Capsella rubellaCarubv10003382mCarubv10003258mCarubv10024496mCarubv10003419mCarubv10006454m
Carubv10006236mCarubv10016138m
Citrus clementinaCiclev10024589mCiclev10024189mCiclev10023906mCiclev10030190m
Citrus sinensisorange1.1g043363morange1.1g045265morange1.1g040171m
Cucumis sativusCucsa.362070.1Cucsa.319800.1
Eucalyptus grandisEucgr.A02147.1Eucgr.J00503.1Eucgr.B03840.1Eucgr.B03838.1Eucgr.A00301.1
Eucgr.A00298.1Eucgr.A00295.1Eucgr.A00045.1Eucgr.A00299.2Eucgr.A00299.1
Eucgr.A00042.1Eucgr.A02146.1Eucgr.D00818.1Eucgr.A00296.1
Fragaria vescamrna26378.1-v1.0-hybridmrna07700.1-v1.0-hybridmrna21725.1-v1.0-hybrid
Glycine maxGlyma03g01020.1Glyma03g01010.1Glyma13g42140.1Glyma15g03250.1Glyma19g16960.1
Gossypium raimondiiGorai.009G084400.1Gorai.007G253300.1Gorai.005G126200.1
Linum usitatissimumLus10004859Lus10005679Lus10032511Lus10020312Lus10022962
Lus10004804Lus10025586Lus10013631Lus10001324Lus10005681
Lus10043010Lus10018375Lus10020311
Malus domesticaMDP0000269302MDP0000264903MDP0000243237MDP0000156208
Manihot esculentacassava4.1_024710mcassava4.1_028102mcassava4.1_031145mcassava4.1_022946m
Medicago truncatulaMedtr7g086820.1Medtr7g086870.1
Mimulus guttatusmgv1a010343mmgv1a024318mmgv1a022139m
Oryza sativaLOC_Os03g05770.1LOC_Os04g01550.1LOC_Os10g41720.1LOC_Os09g15510.1LOC_Os09g15500.1
Panicum virgatumPavirv00070122mPavirv00055443mPavirv00050601mPavirv00048315mPavirv00056057m
Pavirv00026792mPavirv00052815mPavirv00005617mPavirv00066198mPavirv00005755m
Pavirv00010656mPavirv00020133m
Physcomitrella patensPp1s112_99V6.1Pp1s35_32V6.1Pp1s12_174V6.1
Phaseolus vulgarisPhvul.005G154900.1Phvul.004G053800.1Phvul.001G106500.1Phvul.001G106600.1
Picea abiesMA_257706g0010MA_10426168g0010.52.319MA_10426168g0010.52.319MA_180710g0010MA_10293471g0010
MA_10428075g0010MA_63239g0010MA_10372670g0010MA_10426168g0010.347.524MA_10426168g0010.347.524
Populus trichocarpaPotri.001G218500.1Potri.001G218600.1Potri.013G066800.1Potri.015G110200.1Potri.007G132800.1
Prunus persicappa023274mppa026551mppa009513m
Ricinus communis30072.m00092829272.m00004330147.m014371
Setaria italicaSi011748mSi036621mSi036586mSi036567mSi038861m
Si039188m
Selaginella moellendorffii416327
Sorghum bicolorSb06g000490.1Sb01g046800.1Sb01g028640.1Sb01g016620.1Sb01g028610.1
Thellungiella halophilaThhalv10015253mThhalv10014171mThhalv10004528mThhalv10001541mThhalv10025781m
Thhalv10021155mThhalv10026803m
Vitis viniferaGSVIVT01004097001GSVIVT01036100001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)