y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.004G276700.1
FamilyGH1
Protein PropertiesLength: 337 Molecular Weight: 37879.8 Isoelectric Point: 5.4415
ChromosomeChromosome/Scaffold: 04 Start: 61003734 End: 61004872
Descriptionbeta glucosidase 15
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1413150
  RSDFPDNLLFGGSTAAVQIEGSTKFRGKGPSVWDQFIREFPEKKTDNSNLEVAADSYNRYKEDVSILKDLGVNAYRFSIPWTRILADGTLGGGINQEGIN
  HYNSFIDDLIKNGIDPYVTILHFDSPEALESKYGGFLNHSIVNDFKDYAEICFKTFGDRVKNWITMNEPLIMAKMGYAMGEYQATQGGQIGIALNSHYYE
  PYSNTSLDKEAAKRGMDFELGWFMEPLMHGEYPESMRRLVKDRLPVFTLEQNELVKGSFDFIGVNYYTSRYAKNI
Full Sequence
Protein Sequence     Length: 337     Download
MLSISATKCL VRIFVFVLLA CLSSNCQPTQ ESQKEYVSVK RSDFPDNLLF GGSTAAVQIE    60
GSTKFRGKGP SVWDQFIREF PEKKTDNSNL EVAADSYNRY KEDVSILKDL GVNAYRFSIP    120
WTRILADGTL GGGINQEGIN HYNSFIDDLI KNGIDPYVTI LHFDSPEALE SKYGGFLNHS    180
IVNDFKDYAE ICFKTFGDRV KNWITMNEPL IMAKMGYAMG EYQATQGGQI GIALNSHYYE    240
PYSNTSLDKE AAKRGMDFEL GWFMEPLMHG EYPESMRRLV KDRLPVFTLE QNELVKGSFD    300
FIGVNYYTSR YAKNIPSTPN AASASYLVDS NVKCHS*                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028145.0e-7641317320+
PLN02849PLN028491.0e-8110320354+
COG2723BglB8.0e-9044333324+
TIGR03356BGL1.0e-9445319304+
pfam00232Glyco_hydro_13.0e-11144325314+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABW76287.10103305368beta-glucosidase G2 [Medicago truncatula]
DDBJBAA11831.102533279426furostanol glycoside 26-O-beta-glucosidase (F26G) [Costus speciosus]
RefSeqXP_002332805.10413302334predicted protein [Populus trichocarpa]
RefSeqXP_002448027.103933236372hypothetical protein SORBIDRAFT_06g019840 [Sorghum bicolor]
RefSeqXP_002511218.1053328386beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B03933029363A Chain A, Ofloxacin-Like Antibiotics Inhibit Pneumococcal Cell Wall Degrading Virulence Factors
PDB3ptq_A03933029363A Chain A, Ofloxacin-Like Antibiotics Inhibit Pneumococcal Cell Wall Degrading Virulence Factors
PDB3ptm_B03933029363A Chain A, Ofloxacin-Like Antibiotics Inhibit Pneumococcal Cell Wall Degrading Virulence Factors
PDB3ptm_A03933029363A Chain A, Ofloxacin-Like Antibiotics Inhibit Pneumococcal Cell Wall Degrading Virulence Factors
PDB3ptk_B03933029363A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO13077022012200
CO121326278292640
CO12622924312420
CO11788522012200
CO12025924312420