y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G024700.1
FamilyAA7
Protein PropertiesLength: 541 Molecular Weight: 60869.9 Isoelectric Point: 6.581
ChromosomeChromosome/Scaffold: 05 Start: 2167928 End: 2169550
DescriptionFAD-binding Berberine family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7685320
  NLRFSTPNTPKPLVIVTPLNISHVQATIYCSKKHGLEIRTRSGGHDFEGLSFVSPVPFVVIDLVNLRSVDVDVENEEAWVQSGASVGEVYYRINERSTNL
  SFPAAVFRTVGIGGSISGGGDGSLFRKYGLSADNVIDAQLVDANGRVLDRRSMGEDLFWAIRGGGGGSFGIVISWKIKLVHVPSNVTFFSVGRTLEQNAT
  QLLHRWQYVAPNLPNDVYPVVTISTTNASENGTKTVLATFISLFQGGADEFFPLMQERFPELGLVKEDFIEMTWIESLLLMNGLSNETSEILLDRSNRYT
  ILPPFAKSKSDYVREPMPEIALQGLWLHLLEVDEGGTAVLNFFAHGGIMEEISETETPYPHRKGTLYKISYVIAWQEEENNNSQRYISWMRKLYSYMGPF
  VSKSPREAYVNYRDLDIGSNNYYGKTSYKQASNWGRKYFKNNFDRLVYVKTKTDPKNFFKHEQSI
Full Sequence
Protein Sequence     Length: 541     Download
MKSLHRSLSL LFIVVCSLSW VSASANSHDD FLECLYSYHP NESSSITQVI YTETNSSYLA    60
LLNSSIRNLR FSTPNTPKPL VIVTPLNISH VQATIYCSKK HGLEIRTRSG GHDFEGLSFV    120
SPVPFVVIDL VNLRSVDVDV ENEEAWVQSG ASVGEVYYRI NERSTNLSFP AAVFRTVGIG    180
GSISGGGDGS LFRKYGLSAD NVIDAQLVDA NGRVLDRRSM GEDLFWAIRG GGGGSFGIVI    240
SWKIKLVHVP SNVTFFSVGR TLEQNATQLL HRWQYVAPNL PNDVYPVVTI STTNASENGT    300
KTVLATFISL FQGGADEFFP LMQERFPELG LVKEDFIEMT WIESLLLMNG LSNETSEILL    360
DRSNRYTILP PFAKSKSDYV REPMPEIALQ GLWLHLLEVD EGGTAVLNFF AHGGIMEEIS    420
ETETPYPHRK GTLYKISYVI AWQEEENNNS QRYISWMRKL YSYMGPFVSK SPREAYVNYR    480
DLDIGSNNYY GKTSYKQASN WGRKYFKNNF DRLVYVKTKT DPKNFFKHEQ SIPPLLHYTS    540
*                                                                    600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0277GlcD2.0e-1579273205+
pfam08031BBE6.0e-1747553359+
pfam01565FAD_binding_49.0e-2079216139+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002300557.102053521528predicted protein [Populus trichocarpa]
RefSeqXP_002330608.102253524533predicted protein [Populus trichocarpa]
RefSeqXP_002330609.101953520531predicted protein [Populus trichocarpa]
RefSeqXP_002332196.102053514524predicted protein [Populus trichocarpa]
RefSeqXP_002333339.1015351530predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vte_A0255351513A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB4dns_B03053612497A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB4dns_A03053612497A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3tsj_B0275367497A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3tsj_A0275367497A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77743853575350
EY1969172902355240
EX1648602902355240
DT4653032562825370
CU614979268102770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00740.1Aquca_001_00480.1Aquca_026_00213.1Aquca_001_00289.1Aquca_001_00278.1
Aquca_070_00001.1Aquca_006_00398.1Aquca_020_00180.1Aquca_030_00404.1Aquca_009_00318.1
Aquca_006_00397.1Aquca_009_00359.1Aquca_066_00049.1Aquca_008_00189.1Aquca_037_00334.1
Aquca_001_00276.1Aquca_001_00285.1Aquca_009_00360.1
Arabidopsis lyrata917168494545494550890626917162
472778472781914600471318492802
492806472780472779890629470076
890627473304492803902567917159.140.470
917159.140.470890625330958354696494546
473604902566473307
Arabidopsis thalianaAT5G44440.1AT5G44380.1AT5G44360.1AT1G30710.1AT1G34575.1
AT4G20820.1AT4G20840.1AT1G30730.1AT1G26390.1AT1G11770.1
AT1G26410.1AT4G20800.1AT1G30720.1AT1G30740.1AT1G01980.1
AT4G20830.2AT4G20830.1AT2G34810.1AT1G26420.1AT1G26400.1
AT1G26380.1AT1G30700.1AT4G20860.1AT1G30760.1AT2G34790.1
AT5G44390.1AT5G44400.1AT5G44410.1
Brachypodium distachyonBradi3g16460.1Bradi1g38250.1Bradi1g38270.1Bradi3g09380.1Bradi5g17300.1
Bradi4g18970.1Bradi1g38260.1Bradi5g02967.1Bradi5g02900.1
Brassica rapaBra027555Bra033740Bra013501Bra013478Bra033743
Bra014885Bra024719Bra024717Bra014886Bra013476
Bra023126Bra013473Bra019831Bra013475Bra013472
Bra028530Bra031780Bra038798Bra038799Bra020915
Bra005390Bra023127Bra016272Bra023123.188.506Bra023123.188.506
Bra033739Bra023122Bra022992Bra027547Bra021930
Bra006964Bra005392Bra014890Bra023131Bra027553
Bra027549
Carica papayaevm.model.supercontig_21.234evm.model.supercontig_677.3evm.model.supercontig_166.52evm.model.supercontig_2512.1evm.TU.contig_36442.2
evm.model.supercontig_677.6evm.TU.contig_36542.2evm.model.supercontig_677.5evm.model.supercontig_677.4evm.TU.contig_36130.1
evm.TU.contig_34892.1evm.TU.contig_36661.1evm.TU.contig_43917.1evm.model.supercontig_677.7evm.model.supercontig_166.49
evm.model.supercontig_166.51
Capsella rubellaCarubv10007418mCarubv10007797mCarubv10026133mCarubv10007331mCarubv10027532m
Carubv10008827mCarubv10026203mCarubv10004576mCarubv10008759mCarubv10012287m
Carubv10011326mCarubv10011178mCarubv10008831mCarubv10011480mCarubv10011431m
Carubv10008807mCarubv10006337mCarubv10011221mCarubv10004466mCarubv10008739m
Carubv10008832mCarubv10006505mCarubv10008825mCarubv10022944mCarubv10022971m
Carubv10026190mCarubv10008835mCarubv10026198mCarubv10026204m
Citrus clementinaCiclev10014802mCiclev10014810mCiclev10004697mCiclev10018216mCiclev10003189m
Ciclev10027115mCiclev10014815mCiclev10017860mCiclev10027503mCiclev10017832m
Ciclev10017768mCiclev10014826mCiclev10014748mCiclev10027526mCiclev10000814m
Ciclev10004673mCiclev10006465mCiclev10003156mCiclev10000808mCiclev10000802m
Ciclev10006451mCiclev10014838mCiclev10018073mCiclev10014829mCiclev10017845m
Ciclev10018357mCiclev10014857mCiclev10007008mCiclev10014803mCiclev10014726m
Ciclev10017782mCiclev10007159mCiclev10018353mCiclev10018146mCiclev10006703m
Ciclev10006906mCiclev10000813mCiclev10000811mCiclev10003556mCiclev10000810m
Ciclev10000817mCiclev10004013m
Citrus sinensisorange1.1g008842morange1.1g048392morange1.1g036220morange1.1g009297morange1.1g009727m
orange1.1g039163morange1.1g042207morange1.1g046660morange1.1g035812morange1.1g043104m
orange1.1g040700morange1.1g040771morange1.1g015646morange1.1g042223morange1.1g009485m
orange1.1g009399morange1.1g037058morange1.1g009115morange1.1g038259morange1.1g043814m
orange1.1g008779morange1.1g046361morange1.1g009286morange1.1g009342morange1.1g042619m
Cucumis sativusCucsa.048460.1Cucsa.166870.1Cucsa.166810.1Cucsa.048450.1Cucsa.167230.1
Cucsa.167240.1Cucsa.048470.1Cucsa.166840.1Cucsa.167320.1Cucsa.167330.1
Cucsa.048480.1Cucsa.167250.1Cucsa.167300.1Cucsa.167270.1Cucsa.048430.1
Cucsa.166850.1Cucsa.048490.1Cucsa.166860.1Cucsa.166830.1Cucsa.167310.1
Cucsa.167260.1Cucsa.167280.1Cucsa.207580.1
Eucalyptus grandisEucgr.D01625.1Eucgr.D00089.1Eucgr.D00078.1Eucgr.D00086.1Eucgr.D01005.1
Eucgr.D00082.1Eucgr.D01626.1Eucgr.D00076.1Eucgr.D01004.1Eucgr.D00075.1
Eucgr.D01011.1Eucgr.D01623.1Eucgr.L02929.1Eucgr.D00071.1Eucgr.D00073.1
Eucgr.D00077.1Eucgr.D01006.1Eucgr.D01617.1Eucgr.D00074.1Eucgr.D01003.1
Eucgr.D01053.1Eucgr.D00084.1Eucgr.L02344.1Eucgr.D01622.1Eucgr.D00088.1
Eucgr.D01008.1Eucgr.D01614.1Eucgr.D00085.1Eucgr.D01619.1Eucgr.D00070.1
Fragaria vescamrna31189.1-v1.0-hybridmrna20179.1-v1.0-hybridmrna20170.1-v1.0-hybridmrna20167.1-v1.0-hybridmrna20156.1-v1.0-hybrid
mrna20131.1-v1.0-hybridmrna20163.1-v1.0-hybridmrna20166.1-v1.0-hybridmrna20176.1-v1.0-hybridmrna20169.1-v1.0-hybrid
mrna20171.1-v1.0-hybridmrna20132.1-v1.0-hybridmrna20160.1-v1.0-hybridmrna20178.1-v1.0-hybridmrna20173.1-v1.0-hybrid.74.286
mrna20173.1-v1.0-hybrid.74.286mrna20173.1-v1.0-hybrid.74.286mrna20173.1-v1.0-hybrid.562.753mrna20173.1-v1.0-hybrid.562.753mrna20173.1-v1.0-hybrid.562.753
mrna20161.1-v1.0-hybrid
Glycine maxGlyma20g35570.1Glyma10g32070.1Glyma06g47980.1Glyma08g11890.1Glyma05g25460.1
Glyma05g25130.1Glyma08g08500.1Glyma15g14200.1Glyma09g02630.1Glyma05g25470.1
Glyma08g08570.2Glyma09g03120.1Glyma15g14040.1Glyma08g08530.1Glyma15g14210.1
Glyma09g03100.1Glyma08g08520.1Glyma05g25590.1Glyma08g06350.1Glyma05g25540.1
Glyma08g06360.1Glyma09g03290.1Glyma15g14170.1Glyma09g03270.1Glyma15g14060.1
Glyma15g14030.1Glyma09g03130.1Glyma08g08460.1Glyma15g14020.1Glyma09g03090.1
Glyma08g08550.1Glyma05g25580.1Glyma04g12600.1Glyma06g48000.1Glyma09g03283.1
Glyma08g08480.1Glyma07g30940.2Glyma08g08490.1Glyma05g25500.1Glyma05g25450.1
Glyma04g12580.1Glyma15g14080.1Glyma08g08540.1Glyma04g12610.1Glyma05g25485.1
Glyma06g38076.1
Gossypium raimondiiGorai.001G069600.1Gorai.005G121900.1Gorai.011G129700.1Gorai.013G021500.1Gorai.006G197300.1
Gorai.011G007500.1Gorai.011G121800.1Gorai.006G197400.1Gorai.011G007000.1Gorai.007G011000.1
Gorai.011G007800.1Gorai.011G007400.1Gorai.005G023900.1Gorai.009G117200.1Gorai.011G007200.1
Gorai.010G221700.1Gorai.011G007300.1Gorai.005G024100.1Gorai.005G024000.1Gorai.005G024500.1
Gorai.005G024600.1Gorai.010G221400.1Gorai.011G150800.1Gorai.008G278800.1Gorai.005G023600.1
Gorai.012G166900.1Gorai.005G023500.1Gorai.011G007700.1Gorai.008G278900.1Gorai.012G167000.1
Gorai.005G024300.1Gorai.004G168300.1Gorai.005G121800.1Gorai.010G221500.1Gorai.010G142800.1
Gorai.011G007100.1Gorai.008G278700.1Gorai.005G023800.1
Linum usitatissimumLus10010643Lus10023363Lus10023361Lus10023375Lus10038446
Lus10023365Lus10012641Lus10038436Lus10035466Lus10026775
Lus10001965Lus10008410Lus10033516Lus10021289Lus10023366
Lus10038440Lus10023374Lus10038439Lus10038437Lus10018119
Lus10036147Lus10032943Lus10009009Lus10041290Lus10039682
Lus10026290Lus10038445Lus10023376Lus10038442Lus10020858
Malus domesticaMDP0000316265MDP0000157943
Manihot esculentacassava4.1_022715mcassava4.1_032086mcassava4.1_005673mcassava4.1_023171mcassava4.1_025434m
cassava4.1_024802mcassava4.1_005789mcassava4.1_023945mcassava4.1_027438mcassava4.1_021732m
cassava4.1_022638mcassava4.1_029730mcassava4.1_027037mcassava4.1_033641mcassava4.1_004967m
cassava4.1_034231mcassava4.1_004979m
Medicago truncatulaMedtr7g034740.1Medtr3g009880.1Medtr3g009820.1Medtr4g091170.1Medtr4g091150.1
Medtr2g031510.1Medtr2g031490.1Medtr4g091200.1AC233657_27.1Medtr4g091190.1
Medtr3g009760.1Medtr2g031420.1Medtr2g031390.1Medtr2g031460.1
Mimulus guttatusmgv1a020959mmgv1a004329mmgv1a026362mmgv1a004045mmgv1a027155m
mgv1a003949mmgv1a018986mmgv1a021270mmgv1a021309mmgv1a022353m
mgv1a004108mmgv1a004305mmgv1a004698mmgv1a023470mmgv1a004278m
mgv1a004131mmgv1a024002mmgv1a019888mmgv1a026678mmgv1a020088m
mgv1a024529mmgv1a020594mmgv1a004053mmgv1a017902mmgv1a026045m
mgv1a003997m
Oryza sativaLOC_Os08g06190.1LOC_Os08g06170.1LOC_Os08g25490.1LOC_Os06g35590.1LOC_Os08g06180.1
LOC_Os06g35630.1LOC_Os06g35560.1LOC_Os11g30310.1LOC_Os06g35700.1LOC_Os06g35650.1
LOC_Os06g35660.1
Panicum virgatumPavirv00019442mPavirv00068789mPavirv00001496mPavirv00055040mPavirv00068431m
Pavirv00062394mPavirv00029223mPavirv00012042mPavirv00015387mPavirv00032493m
Pavirv00019776mPavirv00013972mPavirv00037665mPavirv00033493mPavirv00020643m
Pavirv00052121mPavirv00043706mPavirv00044998mPavirv00000028mPavirv00039506m
Pavirv00009817mPavirv00028562mPavirv00019648mPavirv00035481mPavirv00068013m
Pavirv00005996mPavirv00005341mPavirv00010885mPavirv00049757mPavirv00069462m
Pavirv00068961mPavirv00034737mPavirv00013174mPavirv00068750m
Phaseolus vulgarisPhvul.007G113300.1Phvul.002G234800.1Phvul.002G199800.1Phvul.005G004700.1Phvul.002G221900.1
Phvul.005G004400.1Phvul.002G221800.1Phvul.002G199500.1Phvul.005G004600.1Phvul.002G222000.1
Phvul.006G124600.1Phvul.002G198800.1Phvul.002G199300.1Phvul.006G125700.1Phvul.006G124800.1
Phvul.002G199200.1Phvul.002G199100.1Phvul.006G125600.1Phvul.006G125000.1Phvul.006G125500.1
Phvul.002G200300.1Phvul.006G124700.1Phvul.002G200600.1Phvul.002G199700.1Phvul.006G125800.1
Phvul.002G200800.1Phvul.002G200700.1Phvul.002G200200.1Phvul.002G200400.1Phvul.006G125400.1
Phvul.002G199000.1Phvul.002G199600.1Phvul.002G200000.1Phvul.002G200100.1
Picea abiesMA_26891g0010MA_162773g0010MA_186285g0010MA_132990g0010
Populus trichocarpaPotri.019G063400.1Potri.011G158400.1Potri.011G163000.1Potri.011G161800.1Potri.001G470100.1
Potri.011G158700.1Potri.001G461500.1Potri.001G440700.1Potri.001G462600.2Potri.001G462600.1
Potri.001G461900.1Potri.001G462100.1Potri.011G161500.1Potri.001G461800.1Potri.001G464800.1
Potri.001G462000.1Potri.011G158100.2Potri.011G158100.1Potri.011G159900.1Potri.001G461700.1
Potri.011G159600.1Potri.011G160900.1Potri.011G161100.1Potri.011G162700.1Potri.011G158300.1
Potri.001G459500.1Potri.T140200.1Potri.001G463300.1Potri.001G463400.1Potri.012G034700.1
Potri.011G157900.1Potri.015G025900.1Potri.011G160400.1Potri.011G160300.1Potri.011G160200.1
Potri.011G159300.1Potri.011G159200.1Potri.011G159100.1Potri.011G155900.1Potri.001G459200.1
Potri.011G156000.1Potri.011G161400.1Potri.006G128900.1Potri.001G463100.1Potri.011G160700.1
Potri.011G161600.1Potri.011G158500.1Potri.011G160500.1Potri.011G159400.1Potri.001G459100.1
Potri.T140100.1Potri.011G158000.1Potri.011G159500.1Potri.011G160100.1Potri.001G462800.1
Potri.011G160000.1Potri.001G462200.1Potri.011G162800.1Potri.001G464700.1Potri.011G158800.1
Potri.011G162900.1Potri.001G462400.1Potri.011G161300.1Potri.011G158600.1Potri.001G462700.1
Potri.001G463500.1
Prunus persicappa023762mppa005451mppa018650mppa004127mppa018446m
ppa023336mppa004021mppa019803mppa014683mppa016588m
ppa004317mppa019761mppa020251mppa026518mppa004087m
ppa017444mppa004076mppa022785mppa024922mppa006568m
ppa024148mppa022296mppa027050mppa022216mppa016294m
ppa004103mppa003798mppa004189mppa026775mppa025579m
ppa026226mppa018084mppa022422m
Ricinus communis28885.m00011130075.m00114930075.m00115630075.m00114530075.m001140
30075.m00114130075.m00114429776.m00047930075.m00113830075.m001143
29776.m00048030075.m00114730075.m00114630075.m00115330075.m001142
30075.m00115130075.m001137
Setaria italicaSi015778mSi013528mSi013532mSi006230mSi013559m
Si012681mSi008271mSi020217mSi016790mSi027882m
Si026223mSi007896mSi008819mSi015253m
Sorghum bicolorSb07g003930.1Sb10g021680.1Sb07g003940.1Sb10g021670.1Sb07g000490.1
Sb04g008542.1Sb05g017260.1Sb07g003960.1Sb07g003920.1Sb10g021700.1
Sb10g021690.1Sb10g021685.1Sb06g014450.1Sb05g017260.2
Thellungiella halophilaThhalv10000840mThhalv10000843mThhalv10000842mThhalv10000846mThhalv10003322m
Thhalv10000845mThhalv10027093mThhalv10007337mThhalv10000844mThhalv10007341m
Thhalv10007336mThhalv10027126mThhalv10007308mThhalv10007344mThhalv10027426m
Thhalv10017619mThhalv10009705mThhalv10007352mThhalv10024886mThhalv10007354m
Thhalv10007313mThhalv10024789mThhalv10016482mThhalv10027353mThhalv10026881m
Thhalv10016496mThhalv10000851mThhalv10000841mThhalv10007327mThhalv10001137m
Vitis viniferaGSVIVT01021726001GSVIVT01021629001GSVIVT01020746001GSVIVT01003283001GSVIVT01015790001
GSVIVT01015792001
Zea maysAC203909.3_FGT007AC203909.3_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)