y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G082700.1
FamilyGT47
Protein PropertiesLength: 455 Molecular Weight: 52072 Isoelectric Point: 9.3227
ChromosomeChromosome/Scaffold: 05 Start: 10128625 End: 10133146
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47793770
  LSLKIYVYDENEIDGLKDLLYGRDGSISSNACLKGQWGSQVKIHRLLLESRFRTRKKEEADLFFVPAYVKCVRMLGGLNDKEINQTYVKVLSQMPYFRRS
  GGRDHIFVFPSGAGAHLFRSWATYINRSIILTPEGDRTDKKDTSAFNTWKDIIIPGNVDDGMMKTGATVFQPLPLSKRKYLANYLGRAQKKVGRLKLIEL
  AKQYPDKLECPELQFSGPNKLGRVEYFQHLGNSKFCLAPRGESSWTLRFYESFFVECVPVILSDQVELPFQNVIDYTEISIKWPSTSIGPELLDYLASI
Full Sequence
Protein Sequence     Length: 455     Download
MSPKPRIFSA HSHTAPLCTR THQIAALILV TATFFFTRLF DQSFPPSPCY LDRHLNLHVA    60
KTNDAGHLLW PDRGYGSHLS LKIYVYDENE IDGLKDLLYG RDGSISSNAC LKGQWGSQVK    120
IHRLLLESRF RTRKKEEADL FFVPAYVKCV RMLGGLNDKE INQTYVKVLS QMPYFRRSGG    180
RDHIFVFPSG AGAHLFRSWA TYINRSIILT PEGDRTDKKD TSAFNTWKDI IIPGNVDDGM    240
MKTGATVFQP LPLSKRKYLA NYLGRAQKKV GRLKLIELAK QYPDKLECPE LQFSGPNKLG    300
RVEYFQHLGN SKFCLAPRGE SSWTLRFYES FFVECVPVIL SDQVELPFQN VIDYTEISIK    360
WPSTSIGPEL LDYLASIPDE VIEQIIGRGR QVRCLWVYAP DSEPCSTMRA LMWELQRKVR    420
QFHQSAETFW LHNGSVVNRN LVEFAKWKPP MPLP*                               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin2.0e-4681377309+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM61682.1024546462unknown [Arabidopsis thaliana]
RefSeqNP_564141.1024546462exostosin family protein [Arabidopsis thaliana]
RefSeqXP_002265632.1044547459PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300942.10645410460predicted protein [Populus trichocarpa]
RefSeqXP_002307477.10645410460predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT56251328312830
CX6688322911414310
FE7079142791213990
CU531100251713210
BX84115533023270
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00344.3Aquca_014_00344.1Aquca_014_00344.2
Arabidopsis lyrata472383
Arabidopsis thalianaAT1G21480.2AT1G21480.1
Brachypodium distachyonBradi5g20997.1
Brassica rapaBra016420Bra017918
Carica papayaevm.model.supercontig_49.73
Capsella rubellaCarubv10009077m
Citrus clementinaCiclev10001673mCiclev10002072mCiclev10001104mCiclev10001922m
Cucumis sativusCucsa.077120.2Cucsa.077120.1
Eucalyptus grandisEucgr.E02380.2Eucgr.E02380.1
Fragaria vescamrna00939.1-v1.0-hybrid
Glycine maxGlyma14g38290.1
Gossypium raimondiiGorai.005G082700.6Gorai.005G082700.3Gorai.005G082700.2Gorai.005G082700.4Gorai.005G082700.5
Linum usitatissimumLus10028632Lus10018930
Malus domesticaMDP0000251576MDP0000259719
Manihot esculentacassava4.1_011268mcassava4.1_012629m
Mimulus guttatusmgv1a006022m
Panicum virgatumPavirv00023264mPavirv00031056m
Physcomitrella patensPp1s48_252V6.1
Phaseolus vulgarisPhvul.001G063800.1
Populus trichocarpaPotri.002G072300.1Potri.005G187400.3Potri.005G187400.2Potri.005G187400.1
Prunus persicappa005428m
Ricinus communis27985.m000889
Setaria italicaSi002210mSi002276mSi001530m
Selaginella moellendorffii104774
Sorghum bicolorSb03g040220.1
Thellungiella halophilaThhalv10007584m
Vitis viniferaGSVIVT01010019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny