y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G082700.5
FamilyGT47
Protein PropertiesLength: 304 Molecular Weight: 34799.1 Isoelectric Point: 9.0765
ChromosomeChromosome/Scaffold: 05 Start: 10128625 End: 10133146
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4772260
  DKEINQTYVKVLSQMPYFRRSGGRDHIFVFPSGAGAHLFRSWATYINRSIILTPEGDRTDKKDTSAFNTWKDIIIPGNVDDGMMKTGATVFQPLPLSKRK
  YLANYLGRAQKKVGRLKLIELAKQYPDKLECPELQFSGPNKLGRVEYFQHLGNSKFCLAPRGESSWTLRFYESFFVECVPVILSDQVELPFQNVIDYTEI
  SIKWPSTSIGPELLDYLASI
Full Sequence
Protein Sequence     Length: 304     Download
MLGGLNDKEI NQTYVKVLSQ MPYFRRSGGR DHIFVFPSGA GAHLFRSWAT YINRSIILTP    60
EGDRTDKKDT SAFNTWKDII IPGNVDDGMM KTGATVFQPL PLSKRKYLAN YLGRAQKKVG    120
RLKLIELAKQ YPDKLECPEL QFSGPNKLGR VEYFQHLGNS KFCLAPRGES SWTLRFYESF    180
FVECVPVILS DQVELPFQNV IDYTEISIKW PSTSIGPELL DYLASIPDEV IEQIIGRGRQ    240
VRCLWVYAPD SEPCSTMRAL MWELQRKVRQ FHQSAETFWL HNGSVVNRNL VEFAKWKPPM    300
PLP*                                                                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin6.0e-3214226225+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002265632.101303157459PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300942.101303158460predicted protein [Populus trichocarpa]
RefSeqXP_002307477.101303158460predicted protein [Populus trichocarpa]
RefSeqXP_002458782.101303124426hypothetical protein SORBIDRAFT_03g040220 [Sorghum bicolor]
RefSeqXP_002526175.101303151453catalytic, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX66883228012800
FE707913274313040
EH69264527072760
FE70791424812480
GR005989247372830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00344.3Aquca_014_00344.1Aquca_014_00344.2
Arabidopsis lyrata472383
Arabidopsis thalianaAT1G21480.2AT1G21480.1
Brachypodium distachyonBradi5g20997.1
Brassica rapaBra016420Bra017918
Carica papayaevm.model.supercontig_49.73
Capsella rubellaCarubv10009077m
Citrus clementinaCiclev10001673mCiclev10002072mCiclev10001104mCiclev10001922m
Cucumis sativusCucsa.077120.2Cucsa.077120.1
Eucalyptus grandisEucgr.E02380.2Eucgr.E02380.1
Fragaria vescamrna00939.1-v1.0-hybrid
Glycine maxGlyma14g38290.1
Gossypium raimondiiGorai.005G082700.1Gorai.005G082700.6Gorai.005G082700.3Gorai.005G082700.2Gorai.005G082700.4
Linum usitatissimumLus10028632Lus10018930
Malus domesticaMDP0000251576MDP0000259719
Manihot esculentacassava4.1_011268mcassava4.1_012629m
Mimulus guttatusmgv1a006022m
Panicum virgatumPavirv00023264mPavirv00031056m
Physcomitrella patensPp1s48_252V6.1
Phaseolus vulgarisPhvul.001G063800.1
Populus trichocarpaPotri.002G072300.1Potri.005G187400.3Potri.005G187400.2Potri.005G187400.1
Prunus persicappa005428m
Ricinus communis27985.m000889
Setaria italicaSi002210mSi002276mSi001530m
Selaginella moellendorffii104774
Sorghum bicolorSb03g040220.1
Thellungiella halophilaThhalv10007584m
Vitis viniferaGSVIVT01010019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny