y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G097300.2
FamilyGT43
Protein PropertiesLength: 391 Molecular Weight: 44797.3 Isoelectric Point: 9.4279
ChromosomeChromosome/Scaffold: 05 Start: 14698427 End: 14701385
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT431583660
  LGQVLRLVKPPLVWIVVEEKAASHETAEILRKTGVMYRHVLCAFNSSSVKDPRVHQRNAALEHIERHKLDGIVFFADDDNVYTLELFESLRTISRFGTWP
  VAMLAQSKNKAILEGPVCNASQVIGWHTNDKSKRLRRFYADMSGFAFNSSILWDSKRWARPFSNPIRQLDTVKEGFQESTFIEQVVEDESQMEGIPHGCS
  RIMNWHLHL
Full Sequence
Protein Sequence     Length: 391     Download
MASIRRTLSP AYHDRSYQNG AGFSSPSNKF LPNGSSKHFS SSHLPFLFNA VNIVYRKGWR    60
RSFCRCLFFF VIGFVFGIAP FGYSDTDVRA KDFTFPELKP PHANLRFDDQ IVTSVSLSVN    120
TKLLEPKEST DIIEPLKQLI VVTPTYNRGF QAYFLNRLGQ VLRLVKPPLV WIVVEEKAAS    180
HETAEILRKT GVMYRHVLCA FNSSSVKDPR VHQRNAALEH IERHKLDGIV FFADDDNVYT    240
LELFESLRTI SRFGTWPVAM LAQSKNKAIL EGPVCNASQV IGWHTNDKSK RLRRFYADMS    300
GFAFNSSILW DSKRWARPFS NPIRQLDTVK EGFQESTFIE QVVEDESQME GIPHGCSRIM    360
NWHLHLDTDN LFYPKGWLLE KNLEVILPIK *                                   420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03360Glyco_transf_432.0e-74158368220+
PLN02458PLN024582.0e-77122368254+
cd00218GlcAT-I4.0e-99139368236+
Gene Ontology
GO TermDescription
GO:0015018galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAI93172.1013901394beta-1,3-glucuronosyltransferase [Gossypium raimondii]
EMBLCBI19320.1013901381unnamed protein product [Vitis vinifera]
RefSeqXP_002283625.1013901405PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301102.1013901395glycosyl transferase [Populus trichocarpa]
RefSeqXP_002510001.1013901405beta-1,3-glucuronyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2d0j_D1e-281363712231A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB2d0j_C1e-281363712231A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB2d0j_B1e-281363712231A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB2d0j_A1e-281363712231A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB1v84_B3e-271363632230A Chain A, Crystal Structure Of Human Glcat-S Apo Form
Transmembrane Domains
StartEnd
6284
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO09004126312630
GR1833302471363820
EX6629562571353910
EL3573782441373800
CO11112520112010
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00731.2Aquca_007_00731.1Aquca_001_00368.3Aquca_001_00368.2Aquca_001_00368.1
Aquca_010_00019.1Aquca_027_00094.1
Arabidopsis lyrata912627496876890287902844
Arabidopsis thalianaAT5G67230.1AT4G36890.1AT1G27600.2AT1G27600.1AT2G37090.1
Brachypodium distachyonBradi1g33320.3Bradi1g33320.2Bradi1g33320.1Bradi5g24290.1Bradi3g23120.1
Bradi2g00290.1Bradi5g02350.1Bradi2g46410.1Bradi2g16840.1Bradi1g16540.1
Bradi1g65750.1Bradi1g16540.2Bradi2g37970.3Bradi2g37970.1
Brassica rapaBra012145Bra011745Bra010929Bra030055Bra005218
Carica papayaevm.model.supercontig_55.103evm.model.supercontig_7.258evm.model.supercontig_366.2evm.model.supercontig_286.11
Capsella rubellaCarubv10004588mCarubv10027753mCarubv10009365mCarubv10025381mCarubv10025384m
Citrus clementinaCiclev10025401mCiclev10008306mCiclev10008305mCiclev10008303mCiclev10001397m
Ciclev10012036m
Citrus sinensisorange1.1g013985morange1.1g010452morange1.1g013438morange1.1g013414morange1.1g016070m
orange1.1g016052morange1.1g042066m
Cucumis sativusCucsa.102610.2Cucsa.102610.1Cucsa.312290.4Cucsa.312610.1Cucsa.312290.3
Cucsa.312290.2Cucsa.312290.1.175.269Cucsa.312290.1.175.269Cucsa.307090.2Cucsa.307090.1
Cucsa.312290.1.357.476Cucsa.312290.1.357.476
Eucalyptus grandisEucgr.I00880.2Eucgr.I00880.1Eucgr.H02219.1Eucgr.C00584.1Eucgr.F00463.3
Eucgr.F00463.2Eucgr.F00463.1Eucgr.F02177.3Eucgr.F02177.2Eucgr.F02177.1
Eucgr.A01172.1Eucgr.K03214.1
Fragaria vescamrna23860.1-v1.0-hybridmrna09635.1-v1.0-hybridmrna08813.1-v1.0-hybridmrna26845.1-v1.0-hybrid
Glycine maxGlyma17g18450.2Glyma17g18450.1Glyma16g16280.1Glyma11g05640.1Glyma01g39610.1
Glyma05g20910.2Glyma06g08820.1Glyma04g08720.2Glyma04g08720.1Glyma03g33570.1
Glyma19g36280.1Glyma10g05730.2Glyma10g05730.1Glyma13g20080.1Glyma13g20080.2
Glyma06g09560.1Glyma04g09470.2
Gossypium raimondiiGorai.007G216800.2Gorai.007G216800.1Gorai.003G026800.1Gorai.004G051000.1Gorai.004G051100.1
Gorai.004G290300.4Gorai.004G290300.3Gorai.004G290300.2Gorai.004G290300.1Gorai.009G051500.3
Gorai.009G051500.2Gorai.009G051500.1Gorai.005G097300.3Gorai.005G097300.1Gorai.002G137600.1
Gorai.006G168500.1Gorai.010G031000.2Gorai.010G031000.1Gorai.006G168500.2
Linum usitatissimumLus10010268Lus10041601Lus10011500Lus10019325Lus10032817
Lus10007692Lus10019917Lus10026487Lus10015069
Malus domesticaMDP0000186002MDP0000308871MDP0000207693MDP0000287243MDP0000666177
MDP0000703247MDP0000259253MDP0000487987MDP0000131594MDP0000126039
MDP0000130817
Manihot esculentacassava4.1_006028mcassava4.1_006067mcassava4.1_008517mcassava4.1_007765mcassava4.1_008594m
cassava4.1_031170mcassava4.1_029083m
Medicago truncatulaMedtr5g016600.1AC225517_17.1Medtr3g111060.1Medtr7g100800.1
Mimulus guttatusmgv1a004664mmgv1a008341mmgv1a011740mmgv1a020319mmgv1a007326m
mgv1a007301mmgv1a010149mmgv1a009864m
Oryza sativaLOC_Os06g47340.1LOC_Os04g55670.1LOC_Os10g13810.1LOC_Os03g17850.1LOC_Os01g48440.1
LOC_Os01g48440.3LOC_Os01g48440.2LOC_Os05g48600.2LOC_Os05g48600.1LOC_Os01g06450.1
LOC_Os04g01280.1LOC_Os05g03174.2LOC_Os05g03174.1LOC_Os07g49370.1
Panicum virgatumPavirv00070690mPavirv00002442mPavirv00049605mPavirv00049604mPavirv00066013m
Pavirv00015553mPavirv00048742mPavirv00020159mPavirv00023302mPavirv00014028m
Pavirv00068635mPavirv00020160mPavirv00041023mPavirv00041022mPavirv00069320m
Pavirv00069319mPavirv00064679mPavirv00025005mPavirv00063696mPavirv00054446m
Pavirv00038884mPavirv00043409mPavirv00036401m
Physcomitrella patensPp1s248_13V6.1Pp1s78_128V6.1Pp1s19_221V6.1Pp1s1_540V6.1Pp1s52_108V6.1
Phaseolus vulgarisPhvul.002G016000.1Phvul.009G107900.2Phvul.009G107900.1Phvul.001G175200.1Phvul.007G164400.2
Phvul.009G146400.1Phvul.007G164400.1
Picea abiesMA_10433413g0010MA_9135945g0010MA_10426088g0010MA_42440g0010
Populus trichocarpaPotri.007G047500.2Potri.007G047500.1Potri.005G141500.1Potri.002G107300.3Potri.002G107300.2
Potri.002G107300.1Potri.006G240200.1Potri.006G240200.2Potri.006G131000.2Potri.006G131000.1
Potri.016G086400.1Potri.018G039900.1
Prunus persicappa004411mppa005926mppa006476mppa007640m
Ricinus communis29794.m00343730170.m01362129805.m001478
Setaria italicaSi006224mSi010088mSi002282mSi036401mSi001449m
Si022019mSi010329mSi010328mSi005128mSi030381m
Si022408m
Selaginella moellendorffii1208278265416278
Sorghum bicolorSb10g027970.1Sb06g030810.1Sb03g011010.1Sb09g028220.1Sb03g030990.1
Sb06g000430.1Sb01g038640.1Sb03g005410.1Sb09g002200.1Sb02g044020.1
Thellungiella halophilaThhalv10024924mThhalv10004084mThhalv10007547mThhalv10016877m
Vitis viniferaGSVIVT01022064001GSVIVT01035647001GSVIVT01025636001GSVIVT01009245001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)