y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G126200.1
FamilyAA2
Protein PropertiesLength: 340 Molecular Weight: 37951.4 Isoelectric Point: 8.2995
ChromosomeChromosome/Scaffold: 05 Start: 28170634 End: 28173071
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2633195.60519e-45
  YKYDKTIAPKLLRLLYADCFVNGCDASVLLDGPNSEKTAPQNRGLAGFAFIDKIKTVLEARCPGVVSCADILNLATRDAVHLAGAPSYPVYTGRRDGMTS
  TKDSVDLPSPSISWEASLTYFRSRGLDVLDMTTLLGAHSMGRTHCSFIVDRLYNFNDTGKPDPSMKASLLEEMRKLCPPKTKKGQPDPLIFLNPASGSKY
  SFINSYYSRVLTNEAVLGVDQQLLYNEDTKQITEEFAAGFEDFRRSFALSMSRMGNI
Full Sequence
Protein Sequence     Length: 340     Download
MRRERLGFGF ALAVLSLWCS MEVAVEAAWS LQTPVNLVWH YYKVHNTCDN AEAYIRHQVE    60
SFYKYDKTIA PKLLRLLYAD CFVNGCDASV LLDGPNSEKT APQNRGLAGF AFIDKIKTVL    120
EARCPGVVSC ADILNLATRD AVHLAGAPSY PVYTGRRDGM TSTKDSVDLP SPSISWEASL    180
TYFRSRGLDV LDMTTLLGAH SMGRTHCSFI VDRLYNFNDT GKPDPSMKAS LLEEMRKLCP    240
PKTKKGQPDP LIFLNPASGS KYSFINSYYS RVLTNEAVLG VDQQLLYNED TKQITEEFAA    300
GFEDFRRSFA LSMSRMGNIN VLTGKEGEIR KNCRFPNKK*                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like4.0e-1955318287+
pfam00141peroxidase4.0e-5955201149+
PLN03030PLN030305.0e-8247333294+
cd00693secretory_peroxidase3.0e-14336335304+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PIR0153376325UP10_LACSN Unknown protein 10 from 2D-PAGE
GenBankAAL84934.101533716335At2g43480/T1O24.22 [Arabidopsis thaliana]
EMBLCAN61767.10133725363hypothetical protein [Vitis vinifera]
RefSeqNP_181876.201533716335peroxidase, putative [Arabidopsis thaliana]
RefSeqNP_197795.101033710335peroxidase family protein [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A04733411301A Chain A, Ubiquitin-Conjugating Enzyme E2q
PDB1pa2_A04733411301A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1qgj_B04733810300A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A04733810300A Chain A, Arabidopsis Thaliana Peroxidase N
PDB4a5g_B04733712305A Chain A, Raphanus Sativus Anionic Peroxidase.
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX280754285102940
EX260107273102820
JZ012912267723370
GE347064255372900
FN703782232252560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_028_00270.1
Arabidopsis lyrata488648489264483456913963354185
477612489097
Arabidopsis thalianaAT5G22410.1AT5G17820.1AT2G43480.1AT5G24070.1AT3G03670.1
AT4G26010.1AT1G34510.1
Brachypodium distachyonBradi3g33780.1Bradi3g10460.1Bradi3g10470.1
Brassica rapaBra006423Bra023639Bra036445Bra037713Bra009728
Bra026470Bra019132Bra013943Bra001084Bra019131
Bra020191
Carica papayaevm.model.supercontig_161.43evm.model.supercontig_1040.1evm.model.supercontig_13.208evm.model.supercontig_195.9
Capsella rubellaCarubv10003382mCarubv10003258mCarubv10024496mCarubv10003419mCarubv10006454m
Carubv10006236mCarubv10016138m
Citrus clementinaCiclev10024589mCiclev10024189mCiclev10023906mCiclev10030190m
Citrus sinensisorange1.1g043363morange1.1g045265morange1.1g040171m
Cucumis sativusCucsa.362070.1Cucsa.319800.1
Eucalyptus grandisEucgr.A02147.1Eucgr.J00503.1Eucgr.B03840.1Eucgr.B03838.1Eucgr.A00301.1
Eucgr.A00298.1Eucgr.A00295.1Eucgr.A00045.1Eucgr.A00299.2Eucgr.A00299.1
Eucgr.A00042.1Eucgr.A02146.1Eucgr.D00818.1Eucgr.A00296.1
Fragaria vescamrna26378.1-v1.0-hybridmrna07700.1-v1.0-hybridmrna21725.1-v1.0-hybrid
Glycine maxGlyma03g01020.1Glyma03g01010.1Glyma13g42140.1Glyma15g03250.1Glyma19g16960.1
Gossypium raimondiiGorai.004G252800.1Gorai.009G084400.1Gorai.007G253300.1
Linum usitatissimumLus10004859Lus10005679Lus10032511Lus10020312Lus10022962
Lus10004804Lus10025586Lus10013631Lus10001324Lus10005681
Lus10043010Lus10018375Lus10020311
Malus domesticaMDP0000269302MDP0000264903MDP0000243237MDP0000156208
Manihot esculentacassava4.1_024710mcassava4.1_028102mcassava4.1_031145mcassava4.1_022946m
Medicago truncatulaMedtr7g086820.1Medtr7g086870.1
Mimulus guttatusmgv1a010343mmgv1a024318mmgv1a022139m
Oryza sativaLOC_Os03g05770.1LOC_Os04g01550.1LOC_Os10g41720.1LOC_Os09g15510.1LOC_Os09g15500.1
Panicum virgatumPavirv00070122mPavirv00055443mPavirv00050601mPavirv00048315mPavirv00056057m
Pavirv00026792mPavirv00052815mPavirv00005617mPavirv00066198mPavirv00005755m
Pavirv00010656mPavirv00020133m
Physcomitrella patensPp1s112_99V6.1Pp1s35_32V6.1Pp1s12_174V6.1
Phaseolus vulgarisPhvul.005G154900.1Phvul.004G053800.1Phvul.001G106500.1Phvul.001G106600.1
Picea abiesMA_257706g0010MA_10426168g0010.52.319MA_10426168g0010.52.319MA_180710g0010MA_10293471g0010
MA_10428075g0010MA_63239g0010MA_10372670g0010MA_10426168g0010.347.524MA_10426168g0010.347.524
Populus trichocarpaPotri.001G218500.1Potri.001G218600.1Potri.013G066800.1Potri.015G110200.1Potri.007G132800.1
Prunus persicappa023274mppa026551mppa009513m
Ricinus communis30072.m00092829272.m00004330147.m014371
Setaria italicaSi011748mSi036621mSi036586mSi036567mSi038861m
Si039188m
Selaginella moellendorffii416327
Sorghum bicolorSb06g000490.1Sb01g046800.1Sb01g028640.1Sb01g016620.1Sb01g028610.1
Thellungiella halophilaThhalv10015253mThhalv10014171mThhalv10004528mThhalv10001541mThhalv10025781m
Thhalv10021155mThhalv10026803m
Vitis viniferaGSVIVT01004097001GSVIVT01036100001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)