y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G129100.2
FamilyGT8
Protein PropertiesLength: 608 Molecular Weight: 68807.8 Isoelectric Point: 8.0951
ChromosomeChromosome/Scaffold: 05 Start: 31303031 End: 31309906
Descriptiongalacturonosyltransferase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT82865790
  CLSMRLTVEYFRDHLFDKELSEKYSDPTLQHYVIFSNNVIASSVVINSTVVHARDTVNQVFHVLTDWQNYYAMKHWFLRNTFRDAVVQVLNIEDSDSYGK
  ATLSHLTLPVEFRVSFPSNDSAPAIHNRTQYVSIFSHSHYLLPEIFKNLEKVVVLDDDVVVQQDLSALWSLNMGGKVTGAIEICSVKMDQLQSYLGDHSF
  QKHSCSWMSGLNVIDLARWRDLDISETYWKLVKEVSMKEGSALLATLLTFQDQIYALDRVWVLSGLGHDYGLDIEGIKKAAVLHYNGNMKPWLD
Full Sequence
Protein Sequence     Length: 608     Download
MKGGSGGGGG VAPAKRRWRG LAIAVLFLVV LSMLVPLGFL LGLHSGFHSA GHIPLQRPSP    60
SGDRSSHIDN LVRKLGPTLP KDVLKGFVNE AKNETSSINA TPRTEQKKGI PIPPQVVMQP    120
FTSKNISRIN GKAKMKSDVD ESEGFCDLKY GSYCIWREEN REEMQDSMVK KLKDQLFVAR    180
AYFPSIAKIP AQSKLSGELK QNIQEVERVL SESTTDADLP PEIQKKSRRM EAVIARAKSV    240
SLDCNNVDKK LRQIFDLTED EANFHMKQSA FLYQLAVQTM PKSLHCLSMR LTVEYFRDHL    300
FDKELSEKYS DPTLQHYVIF SNNVIASSVV INSTVVHARD TVNQVFHVLT DWQNYYAMKH    360
WFLRNTFRDA VVQVLNIEDS DSYGKATLSH LTLPVEFRVS FPSNDSAPAI HNRTQYVSIF    420
SHSHYLLPEI FKNLEKVVVL DDDVVVQQDL SALWSLNMGG KVTGAIEICS VKMDQLQSYL    480
GDHSFQKHSC SWMSGLNVID LARWRDLDIS ETYWKLVKEV SMKEGSALLA TLLTFQDQIY    540
ALDRVWVLSG LGHDYGLDIE GIKKAAVLHY NGNMKPWLDL GIPKYKEYWK KFLNHEDQYL    600
SECNVNR*                                                             660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02742PLN027424.0e-85162604470+
PLN02718PLN027181.0e-98162605459+
PLN02910PLN029103.0e-106139606491+
PLN02829PLN028293.0e-113164606461+
PLN02769PLN02769013606619+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAQ58617.1013360653540transferase, transferring glycosyl groups / unknown protein [Vitis vinifera]
RefSeqNP_565893.104560645618GAUT7 (GALACTURONOSYLTRANSFERASE 7); polygalacturonate 4-alpha-galacturonosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002264525.104560648612PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323701.10136606142619glycosyltransferase, CAZy family GT8 [Populus trichocarpa]
RefSeqXP_002519984.1013660797576Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.000241557777252X Chain X, Solution Structure Of The M-Pmv Wild Type Matrix Protein (P10)
PDB1g9r_A0.000241557777252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.00341557777252A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
Transmembrane Domains
StartEnd
2143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0810832712595280
EX2882353321745030
EE6085002731464180
EE6103532741484210
EX0499772311483780
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma16g09405.1Glyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.006G236100.1Gorai.006G236100.2Gorai.006G236100.3
Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)