y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G137400.1
FamilyGT29
Protein PropertiesLength: 484 Molecular Weight: 54994.1 Isoelectric Point: 9.4133
ChromosomeChromosome/Scaffold: 05 Start: 35546622 End: 35552408
DescriptionMALE GAMETOPHYTE DEFECTIVE 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291653611.20512e-43
  DKCYNRTLCEEHLNVLLPAKPPFHPRQFRTCAVVGNSGDLLKTEFGKEIDSHDAVIRDNEAPVNEKYAKYVGLKRDFRLVVRGAARNMIKILKGSNDEVL
  IIKSVTHKDFSDMIKSIPNPVYLFQGIVLRRGAKGTGMKSIELALSMCDIVDIYGFTVDPGYTEWTRYFSTPRKGHNPLQGRAYYQLLECLGVIRIH
Full Sequence
Protein Sequence     Length: 484     Download
MRSRSQFQSH KKSTLLPLVC AAAFFSLLLF GIQSSFFSGR INRKIDLGKE KMQVSDLSPQ    60
ELRSLAEFQT RVQQCVANRG LGLTAHLVDL CKLTLKFPEG TNSTWYNEQF KVFEPLEYHY    120
DICDAILLWE QYRNMTTVLT REYLDARPDG WLDYAAKRIA QLGADKCYNR TLCEEHLNVL    180
LPAKPPFHPR QFRTCAVVGN SGDLLKTEFG KEIDSHDAVI RDNEAPVNEK YAKYVGLKRD    240
FRLVVRGAAR NMIKILKGSN DEVLIIKSVT HKDFSDMIKS IPNPVYLFQG IVLRRGAKGT    300
GMKSIELALS MCDIVDIYGF TVDPGYTEWT RYFSTPRKGH NPLQGRAYYQ LLECLGVIRI    360
HSPMRAKRKQ DWSDVPSREM INRAHAAALH FKRGPDGQLG QFGSCKVWGN VDPDNSGPIS    420
GSSDMSDVRK HSNYSKWETM PFKSIRKEAQ DHFKQMEGVS MYKIDGNKLD DLVCVRHSVN    480
SKG*                                                                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_293.0e-51152364256+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ15155.106548348469sialyltransferase-like protein [Solanum tuberosum]
EMBLCBI21279.101447818472unnamed protein product [Vitis vinifera]
RefSeqNP_850940.1014791470glycosyl transferase family 29 protein / sialyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002320429.10104836474predicted protein [Populus trichocarpa]
RefSeqXP_002512844.101145712444alpha-2,8-sialyltransferase 8b, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.00000000000619334598266A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nup192, Residues 2 To 960 [scnup192(2-96
PDB2wnb_A0.00000000000619334598266A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.00000000000719334598266A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR9147972981204140
CK254085333113400
EY7151712871894750
CO1111382402174560
JK9890602692164810
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00108.5Aquca_019_00142.1Aquca_004_00108.4Aquca_004_00108.3Aquca_004_00108.2
Aquca_004_00108.1
Arabidopsis lyrata906136470934
Arabidopsis thalianaAT3G48820.2AT3G48820.1AT1G08660.1AT1G08660.2
Brachypodium distachyonBradi3g01700.2Bradi3g01700.3Bradi3g01700.1Bradi1g67467.1
Brassica rapaBra019569Bra031637
Carica papayaevm.model.supercontig_4.113evm.model.supercontig_70.73
Capsella rubellaCarubv10017505mCarubv10017208mCarubv10009607mCarubv10009038m
Citrus clementinaCiclev10031577mCiclev10031575mCiclev10031902m
Citrus sinensisorange1.1g013814morange1.1g013792morange1.1g017903morange1.1g017882morange1.1g022244m
orange1.1g019465morange1.1g011883m
Cucumis sativusCucsa.014710.2Cucsa.014710.1Cucsa.156010.2Cucsa.156010.1
Eucalyptus grandisEucgr.F04117.1Eucgr.I01604.1Eucgr.G01933.1
Fragaria vescamrna06450.1-v1.0-hybridmrna01393.1-v1.0-hybrid
Glycine maxGlyma05g34110.1Glyma08g05580.4Glyma08g05580.3Glyma08g05580.1Glyma08g05580.2
Glyma19g27546.1Glyma16g05340.1
Gossypium raimondiiGorai.008G209800.2Gorai.008G209800.1Gorai.005G137400.2Gorai.005G137400.3
Linum usitatissimumLus10032547Lus10043193Lus10035162Lus10031992
Malus domesticaMDP0000239581MDP0000149927MDP0000165459MDP0000211019MDP0000304668
MDP0000244138
Manihot esculentacassava4.1_007830mcassava4.1_008832m
Medicago truncatulaMedtr7g084010.1Medtr8g099840.2Medtr8g099840.1
Mimulus guttatusmgv1a023151mmgv1a005647m
Oryza sativaLOC_Os02g02620.1LOC_Os11g36420.1
Panicum virgatumPavirv00016935mPavirv00068699mPavirv00023972mPavirv00062875mPavirv00062874m
Physcomitrella patensPp1s457_24V6.1Pp1s209_60V6.1
Phaseolus vulgarisPhvul.002G327200.1Phvul.001G084900.1
Picea abiesMA_30391g0010MA_932319g0010
Populus trichocarpaPotri.015G104100.1Potri.014G145400.2Potri.014G145400.1
Prunus persicappa005917mppa005273m
Ricinus communis30147.m01442930131.m006986
Setaria italicaSi017190mSi026296m
Selaginella moellendorffii406168831178267676584403717
760757656779823
Sorghum bicolorSb04g001370.1Sb05g022210.1
Thellungiella halophilaThhalv10010382mThhalv10007525m
Vitis viniferaGSVIVT01008625001GSVIVT01032992001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)