y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G137400.2
FamilyGT29
Protein PropertiesLength: 385 Molecular Weight: 43956.3 Isoelectric Point: 8.8448
ChromosomeChromosome/Scaffold: 05 Start: 35546673 End: 35552358
DescriptionMALE GAMETOPHYTE DEFECTIVE 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT29662626.86636e-44
  DKCYNRTLCEEHLNVLLPAKPPFHPRQFRTCAVVGNSGDLLKTEFGKEIDSHDAVIRDNEAPVNEKYAKYVGLKRDFRLVVRGAARNMIKILKGSNDEVL
  IIKSVTHKDFSDMIKSIPNPVYLFQGIVLRRGAKGTGMKSIELALSMCDIVDIYGFTVDPGYTEWTRYFSTPRKGHNPLQGRAYYQLLECLGVIRIH
Full Sequence
Protein Sequence     Length: 385     Download
MSWCLQYNEQ FKVFEPLEYH YDICDAILLW EQYRNMTTVL TREYLDARPD GWLDYAAKRI    60
AQLGADKCYN RTLCEEHLNV LLPAKPPFHP RQFRTCAVVG NSGDLLKTEF GKEIDSHDAV    120
IRDNEAPVNE KYAKYVGLKR DFRLVVRGAA RNMIKILKGS NDEVLIIKSV THKDFSDMIK    180
SIPNPVYLFQ GIVLRRGAKG TGMKSIELAL SMCDIVDIYG FTVDPGYTEW TRYFSTPRKG    240
HNPLQGRAYY QLLECLGVIR IHSPMRAKRK QDWSDVPSRE MINRAHAAAL HFKRGPDGQL    300
GQFGSCKVWG NVDPDNSGPI SGSSDMSDVR KHSNYSKWET MPFKSIRKEA QDHFKQMEGV    360
SMYKIDGNKL DDLVCVRHSV NSKG*                                          420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_297.0e-5253265256+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ15147.20738489469sialyltransferase-like protein [Solanum lycopersicum]
EMBLCAJ15155.10738489469sialyltransferase-like protein [Solanum tuberosum]
EMBLCBI21279.10737997472unnamed protein product [Vitis vinifera]
RefSeqXP_002320429.10738494474predicted protein [Populus trichocarpa]
RefSeqXP_002512844.10735895444alpha-2,8-sialyltransferase 8b, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000000000069422498250A Chain A, Dipeptide Binding Protein Complex With Glycyl-L-Leucine
PDB2wnb_A0.0000000000069422498250A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.0000000000069422498250A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR914797298213150
EY715171287903760
CO1111382401183570
JK9890602691173820
GE609557257362920
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00108.5Aquca_019_00142.1Aquca_004_00108.4Aquca_004_00108.3Aquca_004_00108.2
Aquca_004_00108.1
Arabidopsis lyrata906136470934
Arabidopsis thalianaAT3G48820.2AT3G48820.1AT1G08660.1AT1G08660.2
Brachypodium distachyonBradi3g01700.2Bradi3g01700.3Bradi3g01700.1Bradi1g67467.1
Brassica rapaBra019569Bra031637
Carica papayaevm.model.supercontig_4.113evm.model.supercontig_70.73
Capsella rubellaCarubv10017505mCarubv10017208mCarubv10009607mCarubv10009038m
Citrus clementinaCiclev10031577mCiclev10031575mCiclev10031902m
Citrus sinensisorange1.1g013814morange1.1g013792morange1.1g017903morange1.1g017882morange1.1g022244m
orange1.1g019465morange1.1g011883m
Cucumis sativusCucsa.014710.2Cucsa.014710.1Cucsa.156010.2Cucsa.156010.1
Eucalyptus grandisEucgr.F04117.1Eucgr.I01604.1Eucgr.G01933.1
Fragaria vescamrna06450.1-v1.0-hybridmrna01393.1-v1.0-hybrid
Glycine maxGlyma05g34110.1Glyma08g05580.4Glyma08g05580.3Glyma08g05580.1Glyma08g05580.2
Glyma19g27546.1Glyma16g05340.1
Gossypium raimondiiGorai.008G209800.2Gorai.008G209800.1Gorai.005G137400.1Gorai.005G137400.3
Linum usitatissimumLus10032547Lus10043193Lus10035162Lus10031992
Malus domesticaMDP0000239581MDP0000149927MDP0000165459MDP0000211019MDP0000304668
MDP0000244138
Manihot esculentacassava4.1_007830mcassava4.1_008832m
Medicago truncatulaMedtr7g084010.1Medtr8g099840.2Medtr8g099840.1
Mimulus guttatusmgv1a023151mmgv1a005647m
Oryza sativaLOC_Os02g02620.1LOC_Os11g36420.1
Panicum virgatumPavirv00016935mPavirv00068699mPavirv00023972mPavirv00062875mPavirv00062874m
Physcomitrella patensPp1s457_24V6.1Pp1s209_60V6.1
Phaseolus vulgarisPhvul.002G327200.1Phvul.001G084900.1
Picea abiesMA_30391g0010MA_932319g0010
Populus trichocarpaPotri.015G104100.1Potri.014G145400.2Potri.014G145400.1
Prunus persicappa005917mppa005273m
Ricinus communis30147.m01442930131.m006986
Setaria italicaSi017190mSi026296m
Selaginella moellendorffii406168831178267676584403717
760757656779823
Sorghum bicolorSb04g001370.1Sb05g022210.1
Thellungiella halophilaThhalv10010382mThhalv10007525m
Vitis viniferaGSVIVT01008625001GSVIVT01032992001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)