y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G138000.1
FamilyCBM57
Protein PropertiesLength: 625 Molecular Weight: 68716 Isoelectric Point: 5.4908
ChromosomeChromosome/Scaffold: 05 Start: 35767361 End: 35774202
DescriptionDi-glucose binding protein with Leucine-rich repeat domain
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572153551.3e-24
  DAFGRSWQSDSDYRAGKSESAKVITTKEKITGTEKAPNYFPMKLYQSAVTIEGRLEYELPVDAKLDYLVWFHFAEIDSTVKKAGERVFDVLVNDKNVSRV
  DIFKEVGSFVAYSLNYTEKNLSSSVLNVKLSPVAGAPLICG
Full Sequence
Protein Sequence     Length: 625     Download
MSFLFLFLLS LAPLFHSSSP LPYPYNTSFH IDCGSSTPST DSYNISWLPD KFFTGGSTSV    60
VSEPLHFHLQ HEKTLRYFPL SSGKKNCYNI PLPAGRYYIR TFTVYDNYDG KSHSPSFDAS    120
VEGTLVFSWR SPWPESLTRD GAYSDLFAFV KDGQLDLCFY SIATDPPVIA SLEVVQIDPL    180
SYNSAQTGDS YILVNYGRLS PGSSQWGPGF TSDPDAFGRS WQSDSDYRAG KSESAKVITT    240
KEKITGTEKA PNYFPMKLYQ SAVTIEGRLE YELPVDAKLD YLVWFHFAEI DSTVKKAGER    300
VFDVLVNDKN VSRVDIFKEV GSFVAYSLNY TEKNLSSSVL NVKLSPVAGA PLICGLENYA    360
MVPADLATVP EQVVAMKALK DSLCVPDRMG WNGDPCAPTD WDAWEGVTCH TNKNGTGLVI    420
TQIELGSQGL KGYISEQISL LSNLINLNLS TNSLDGTLPI GLGQKSLARL DLSDNQFSGS    480
IPESLTSSNL QLVRLNNNLL EGRVPEELYS VGVHGGTIDL SGNKGLCGVP PLPDCPLFWE    540
NGRLSKGGKI AIGLSCFLFV AVLLLVIYLF CIRRGRNDYD FGLPSDLISL AAKRNRYQRQ    600
KSLMLLEMES QHAKGLPSVP LNPH*                                          660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001130.0005423524103+
pfam11721Malectin8.0e-627160152+
pfam11721Malectin1.0e-925832367+
pfam12819Malectin_like2.0e-5531361352+
PLN03150PLN031506.0e-9931577572+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG50525.102162422573AC084221_7 hypothetical protein [Arabidopsis thaliana]
RefSeqNP_564237.202162222626leucine-rich repeat protein-related [Arabidopsis thaliana]
RefSeqXP_002281668.101961921622PREDICTED: similar to leucine-rich repeat protein-related [Vitis vinifera]
RefSeqXP_002457393.102661627625hypothetical protein SORBIDRAFT_03g006620 [Sorghum bicolor]
RefSeqXP_002524408.102459419591serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rj0_A0.000005394535608745A Chain A, Xylanase 10a From Sreptomyces Lividans. Cellobiosyl-Enzyme Intermediate At 1.7 A
PDB3rj0_A0.0005430509475556A Chain A, Xylanase 10a From Sreptomyces Lividans. Cellobiosyl-Enzyme Intermediate At 1.7 A
PDB3rj0_A0.003297508328531A Chain A, Xylanase 10a From Sreptomyces Lividans. Cellobiosyl-Enzyme Intermediate At 1.7 A
Transmembrane Domains
StartEnd
550572
Signal Peptide
Cleavage Site
17
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT558701271242940
DT559661272232940
DT572163270232920
CO0771422773085840
CO117029239232610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.011G029600.2Gorai.011G029600.1Gorai.006G087900.8
Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4Gorai.006G087900.3
Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)