y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G162700.1
FamilyAA1
Protein PropertiesLength: 602 Molecular Weight: 68358.5 Isoelectric Point: 9.0713
ChromosomeChromosome/Scaffold: 05 Start: 47221391 End: 47224593
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA11203861.2e-21
  TVPGPTIEALQGIDTYVTWKNFLPSKHILPWDPTIPTAIPATKTGIPTVVHLHGGMHEPANDGNANSWFTAGFKEKGPDWSKGTYHYNNNQQPGSLWYHD
  HAMGLTRVNLLAGLIGAYVIRHPEVEGPLELPHGEEFDRPLIVFDRSFRKDGSIYMNSTGNNPSIHPQWQPEYFGDLIIVNGKAWPKMTVRRRKYRLRII
  NASNARFFRLFFTNGLEFIHVASDSTYLVEPVVTNETLLAPSEIADVVVDFSKSKTDEAVLANDAPY
Full Sequence
Protein Sequence     Length: 602     Download
MKAFPFKAYL SLSLSLTHTQ YSRFLPLFSL VSMRRILLFL LLLAHLGELG AEDRLLNPSK    60
LEMFVDELPD MPKIQGFRML NTSPKPKSLM IGMFKKKWKF HRDLPPTPVF AYGASRRGAT    120
VPGPTIEALQ GIDTYVTWKN FLPSKHILPW DPTIPTAIPA TKTGIPTVVH LHGGMHEPAN    180
DGNANSWFTA GFKEKGPDWS KGTYHYNNNQ QPGSLWYHDH AMGLTRVNLL AGLIGAYVIR    240
HPEVEGPLEL PHGEEFDRPL IVFDRSFRKD GSIYMNSTGN NPSIHPQWQP EYFGDLIIVN    300
GKAWPKMTVR RRKYRLRIIN ASNARFFRLF FTNGLEFIHV ASDSTYLVEP VVTNETLLAP    360
SEIADVVVDF SKSKTDEAVL ANDAPYPYPS GDPVNELNGR VMKFTIKKER EVDTWRVPDK    420
LIQYPSPDLS SATQTRYIAM YEYTSDTDEP THLYINGKPY EAPATETPKA GTSEIWNVIN    480
LTEDNHPMHI HLAVFTVLDQ TELVKAEEFK ACMSKMNDAI KCQISKHARG KKLRVAAHEK    540
GWKNVYKMTP GYVTRILVRF SYIHSNTSYS FDPTGMPGYV YHCHILDHED NAMMRPLVVM    600
K*                                                                   660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10965PRK109652.0e-10455599149+
pfam07731Cu-oxidase_23.0e-11450599162+
PRK10883PRK108833.0e-14209372169+
PRK10965PRK109659.0e-17210374175+
COG2132SufI2.0e-4582600535+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN78466.103060112573hypothetical protein [Vitis vinifera]
EMBLCBI26921.1051601104654unnamed protein product [Vitis vinifera]
RefSeqXP_002284144.105160127577PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315892.105260024572predicted protein [Populus trichocarpa]
RefSeqXP_002531069.10346013575spore coat protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zdw_A0615993508B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB2x88_A0615993508B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB2x87_A0615993508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2bhf_A0615993508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB1w8e_A0615993508A Chain A, Crystal Structure Of The Reconstituted Cota
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778093519846020
HO7965214571466020
ES833412305533570
EY7055082911824720
EY8239072941894820
Orthologous Group
SpeciesID
Arabidopsis lyrata472551
Brassica rapaBra024558Bra016163
Carica papayaevm.model.supercontig_65.123
Capsella rubellaCarubv10020039m
Eucalyptus grandisEucgr.B00864.1Eucgr.B00863.1Eucgr.B00862.1
Glycine maxGlyma20g26270.3Glyma20g26270.2Glyma20g26270.1Glyma10g41010.1
Manihot esculentacassava4.1_004784m
Mimulus guttatusmgv1a004781m
Oryza sativaLOC_Os01g03640.1LOC_Os01g03630.1LOC_Os01g03620.1LOC_Os01g03530.2LOC_Os01g03530.1
Panicum virgatumPavirv00060261mPavirv00051027mPavirv00039074m
Physcomitrella patensPp1s40_48V6.1Pp1s40_48V6.2Pp1s40_48V6.3Pp1s40_48V6.4Pp1s40_48V6.5
Pp1s40_48V6.6
Phaseolus vulgarisPhvul.007G038200.1
Picea abiesMA_64691g0010MA_10432589g0010
Setaria italicaSi005198mSi004323m
Selaginella moellendorffii90700
Sorghum bicolorSb03g007440.1
Thellungiella halophilaThhalv10007182m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny