y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G178600.2
FamilyGT77
Protein PropertiesLength: 617 Molecular Weight: 69856.1 Isoelectric Point: 9.2302
ChromosomeChromosome/Scaffold: 05 Start: 52323770 End: 52327979
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT773785980
  ITNFLVSSLDYETYQFSVMQGLPVFNDPSAPSNISFNDCHFGTECFQRVTKVKSRLVLKILKLGYNVLLSDVDVYWFKNPLPLLSSFGPATLAAQSDEYN
  QTRPINLPRRLNSGFYFARSDAPTISAMGKVVRHAATSGLTEQPSFYDTLCGEGGSTRKGDNRCVEPGTNLTVHFLDRNLFPNGAYLGLWERKNVKSACK
  KQGCLVLHNNWISGRVKKLKR
Full Sequence
Protein Sequence     Length: 617     Download
MLRRGSSRTK QSLAIRSWLA LSPQISVILF SQHHSAASFA KSFGSRALVE SDIDFTFLGV    60
PFFHSMVAKS RAFKSDIYVF MDTETILLPD FVLALNYAHN LDDDWLLFAS PRDVPNFPFY    120
LDEDRKHWLK DGQRIRIQEL QDTLGSSWQW SCCDSRMVIA WNNGVMPLHH GVLPPFLYGK    180
GVYNHWLINE ALSSGLRFVF DASWTISNIA LGDSRRQSNH LVKSSNVSDI EKGSWEYDCN    240
SHLAAVYGLS SLHGFNYSAV MKLVKCDGQY LLINATEDFL HTYAYKKKSL WKRHIPNCWR    300
SKTTLACVVR TIKTWNETSG CSLKDGSVHT KTLKLSFSLE SLLAITADEN KTVVLTVAGY    360
SYKDMLMSWV CRLRHLRITN FLVSSLDYET YQFSVMQGLP VFNDPSAPSN ISFNDCHFGT    420
ECFQRVTKVK SRLVLKILKL GYNVLLSDVD VYWFKNPLPL LSSFGPATLA AQSDEYNQTR    480
PINLPRRLNS GFYFARSDAP TISAMGKVVR HAATSGLTEQ PSFYDTLCGE GGSTRKGDNR    540
CVEPGTNLTV HFLDRNLFPN GAYLGLWERK NVKSACKKQG CLVLHNNWIS GRVKKLKRQV    600
ISGLWDYDIT TRMCLV*                                                   660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans4.0e-49378599223+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN65937.10666151534hypothetical protein [Vitis vinifera]
EMBLCBI18645.101061558607unnamed protein product [Vitis vinifera]
RefSeqNP_177220.20666151537unknown protein [Arabidopsis thaliana]
RefSeqXP_002271910.10666151551PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.10666151550predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES80543431353170
EX1364523102595670
EL3424482503666150
EL3544682853316150
ES805434273163421
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1Glyma08g38866.1
Gossypium raimondiiGorai.005G178600.1
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny