y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G210200.1
FamilyCBM49
Protein PropertiesLength: 622 Molecular Weight: 69054.9 Isoelectric Point: 6.5998
ChromosomeChromosome/Scaffold: 05 Start: 59135452 End: 59138318
Descriptionglycosyl hydrolase 9C1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495306081.4e-29
  RFLHSITNTWNVGKTTYYRHKVVIKNTSEKPITDLKLVIEDLSGNLWGLSPTPVKNTYELPPWLKVLNPGSDCSFVYIQ
GH9254850
  NYGEALDKTFMFLEAQRSGKLPFDQRVKWRGDSGLKDGALQGVDLVGGYYDAGDHVKFGLPMAFSVTMLAWGTIEYRKEITNLNQMGHTLWAIRWGTDYF
  IKAHTQPNVLWGQVGDGDSDHYCWERAEDMTTPRTAYKLDEAHPGSDLAGETAAALAAAAIAFKPYNSSYSELLLVHAKQLFSFADKFRGLYDDSIQCAK
  QFYTSSGYSDELLWAATWLFRATGDEHYLKYVVDNAVYMGGTGWAVKEFSWDNKYAGVQILLSKVLMEQKGGTYTSTLKQYQAKADYFACACLQKNDGYN
  VHLTPGGLMYVHEWNNLQYASAASFLLAVYSDYLSAANAKLTCPDGQIQPHEVLNFAKSQADYILGKNPKSMSYLVGYGPKYPTHVHHRGASIASISVLP
  SMVSCVQGFEAWYRRPETDPNVIYGALVGGPDQNDGFNDDRSSYEQTEPTLSGSAPLVGLF
Full Sequence
Protein Sequence     Length: 622     Download
MNNFNIVACL ILLGFQAAIV LAEFNYGEAL DKTFMFLEAQ RSGKLPFDQR VKWRGDSGLK    60
DGALQGVDLV GGYYDAGDHV KFGLPMAFSV TMLAWGTIEY RKEITNLNQM GHTLWAIRWG    120
TDYFIKAHTQ PNVLWGQVGD GDSDHYCWER AEDMTTPRTA YKLDEAHPGS DLAGETAAAL    180
AAAAIAFKPY NSSYSELLLV HAKQLFSFAD KFRGLYDDSI QCAKQFYTSS GYSDELLWAA    240
TWLFRATGDE HYLKYVVDNA VYMGGTGWAV KEFSWDNKYA GVQILLSKVL MEQKGGTYTS    300
TLKQYQAKAD YFACACLQKN DGYNVHLTPG GLMYVHEWNN LQYASAASFL LAVYSDYLSA    360
ANAKLTCPDG QIQPHEVLNF AKSQADYILG KNPKSMSYLV GYGPKYPTHV HHRGASIASI    420
SVLPSMVSCV QGFEAWYRRP ETDPNVIYGA LVGGPDQNDG FNDDRSSYEQ TEPTLSGSAP    480
LVGLFSKLES LSGNKGPYHK RPTTEQPSQN YHHQETSVPS TKSPGVPPVR FLHSITNTWN    540
VGKTTYYRHK VVIKNTSEKP ITDLKLVIED LSGNLWGLSP TPVKNTYELP PWLKVLNPGS    600
DCSFVYIQEG PQAKVSVLSY Q*                                             660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02340PLN0234003621622+
PLN02171PLN0217101620632+
PLN02420PLN02420012502493+
PLN00119PLN0011909488480+
pfam00759Glyco_hydro_9025486464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27137.1096218615unnamed protein product [Vitis vinifera]
RefSeqNP_175323.102462029626AtGH9C1 (Arabidopsis thaliana glycosyl hydrolase 9C1); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
RefSeqXP_002277177.10306211575PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310080.101862020610glycosyl hydrolase family 9 [Populus trichocarpa]
RefSeqXP_002527135.101262115620endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0244913431A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB1ksc_A0244913431A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB1ks8_A0244913431A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0245604490A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0245604490A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY9681622871714570
HO783495377284030
DY287831336243580
DY274365342243640
DY276095314713820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)