y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G000300.2
FamilyGH38
Protein PropertiesLength: 920 Molecular Weight: 103367 Isoelectric Point: 6.2242
ChromosomeChromosome/Scaffold: 06 Start: 164272 End: 172055
DescriptionGlycosyl hydrolase family 38 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH38443550
  NVHLVPHSHDDVGWLKTVDQYYFGGNNSIRGACVQNVLDSVISALFDDKNRKFIYVEMAFFQRWWRQQSNAKKIKVKELVNSGQLEFINGGMCMHDEATP
  HYIDLIDQTTLGHKYIKDEFNQIPRVGWQIDPFGHSAVQAYLLGAELGFDSLFFARIDYQDRAKRLKEKTLEVVWQGSKSLGSSSQIFTGIFPRHYDPPD
  GFTFEINDVSPPIQDDVLLFDYNVQERVNDFIAAALAQANVTRTNHIMWAMGTDFRYQYANSWFRQMDKFIHYVNQDGRINALYSTPSIYTDAKYAENVQ
  WPLKTDDFFPYA
Full Sequence
Protein Sequence     Length: 920     Download
MPMAMMPMAI ILLVAILLAG GVSSAESSYI EYNTTQRIVP GKINVHLVPH SHDDVGWLKT    60
VDQYYFGGNN SIRGACVQNV LDSVISALFD DKNRKFIYVE MAFFQRWWRQ QSNAKKIKVK    120
ELVNSGQLEF INGGMCMHDE ATPHYIDLID QTTLGHKYIK DEFNQIPRVG WQIDPFGHSA    180
VQAYLLGAEL GFDSLFFARI DYQDRAKRLK EKTLEVVWQG SKSLGSSSQI FTGIFPRHYD    240
PPDGFTFEIN DVSPPIQDDV LLFDYNVQER VNDFIAAALA QANVTRTNHI MWAMGTDFRY    300
QYANSWFRQM DKFIHYVNQD GRINALYSTP SIYTDAKYAE NVQWPLKTDD FFPYADKPNA    360
YWTGYFTSRP AFKGYVRVLS AYYLAARQLE FFKGRSASGP NTEALADALA IAQHHDAVSG    420
TERQHVAADY ALRLSIGYKE AEKVVASSLA FLADSRSSTE QKNSVTSFQQ CPLLNISFCP    480
PSEAALSSGK SLVIIIYNSL GWKREETIRI PVSSERVVVK DSEGREIESQ LIPLSNSTLR    540
IRSQYIKAYL GKKPREIAKY WVAFSVSVPP LGFSTYIVAT TKETEGRSPT ISTMNTYEAS    600
ENNTIEVGQG SLKLLYSADE GKLTRYVNTR NSVTAFAEQS YGYYSGNDGT DKDPQASGAY    660
VFRPNGTFSI KSENQTPLTV VRGPLLDEVH QQLNSWISQV TRVYKGKEHA EVEFSIGPIP    720
VNDGIGKEII TQITTTMRTN KTFYTDSNGR DFIKRIQDFR KDWDLQVNQP IAGNYYPVNL    780
GIYVQDDSTE LSVLVDRSVG ASSLADGQIE LMLHRRLIHD DIRGVGEVLN ETVCVSEGCD    840
GLTILGKFYL RIDHIGEGAK WRRTVGQEIY SPLLLAFSEQ DGNDWMSSHI PTFSGIDPSY    900
SLPDNIAIIT LQVKNKSQN*                                                960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd10809GH38N_AMII_GMII_SfManIII_like3.0e-7342366363+
pfam01074Glyco_hydro_381.0e-9944355316+
cd00451GH38N_AMII_euk7.0e-10943318276+
PLN02701PLN027011.0e-11442827867+
cd10810GH38N_AMII_LAM_like043319279+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI21275.1089121903unnamed protein product [Vitis vinifera]
RefSeqNP_189306.1039121902glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
RefSeqXP_002276199.1089121902PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301760.1039121909predicted protein [Populus trichocarpa]
RefSeqXP_002512839.10119127906lysosomal alpha-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1o7d_A0323253298C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB1hxk_A03082738850A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A03082738850A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A03082738850A Chain A, Golgi Alpha-Mannosidase Ii
PDB1ps3_A03082768880A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7800625793369120
FG2273944941926840
DW492273301673670
HO780062902513409e-38
HO780062244154380.33
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9Gorai.012G082700.8
Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3Gorai.012G082700.2
Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)