y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G005600.3
FamilyGT33
Protein PropertiesLength: 256 Molecular Weight: 28974.2 Isoelectric Point: 9.5792
ChromosomeChromosome/Scaffold: 06 Start: 1086059 End: 1101984
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3361590
  HACVVILGDLGHSPRMQYHALSLARQASLEVDIVAYGGSEPHSAVIENESIHIHTTIQRQKHSHSLPKILYPLMLLLKPIIQFVILLWFLCFKVLPPDAF
  IVQNPPSIPTLMVVKWVSSLRKSAFIVDWHNFGYTLLGLSVGRSSPFVSIYRVL
GT331682540
  QYLYPRLLFIITGKGPEKEKYEEKIKRLNLKRVAFRTMWLSTEEYPLLLGSADLGVYWHTSSSGLDLPMKVVDMFGCGLPVCAVSYS
Full Sequence
Protein Sequence     Length: 256     Download
MHNRVHACVV ILGDLGHSPR MQYHALSLAR QASLEVDIVA YGGSEPHSAV IENESIHIHT    60
TIQRQKHSHS LPKILYPLML LLKPIIQFVI LLWFLCFKVL PPDAFIVQNP PSIPTLMVVK    120
WVSSLRKSAF IVDWHNFGYT LLGLSVGRSS PFVSIYRVLW KEISGGKQYL YPRLLFIITG    180
KGPEKEKYEE KIKRLNLKRV AFRTMWLSTE EYPLLLGSAD LGVYWHTSSS GLDLPMKVVD    240
MFGCGLPVCA VSYSW*                                                    300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03794GT1_wbuB_like9.0e-517125183+
cd03816GT1_ALG1_like1.0e-4117225382+
PLN02275PLN022752.0e-4816425491+
cd03816GT1_ALG1_like6.0e-522157157+
PLN02275PLN022751.0e-681167170+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI19390.10416712173unnamed protein product [Vitis vinifera]
EMBLCBI19390.10157254311408unnamed protein product [Vitis vinifera]
RefSeqXP_002283369.104167127288PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330745.1011671165predicted protein [Populus trichocarpa]
RefSeqXP_002330745.10154254299399predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
7496
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG84984415611560
CN90010316531670
FC89661216711670
JG61181116531670
FC89433816711670
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_718_00001.2Aquca_095_00006.1.267.395Aquca_095_00006.1.10.256Aquca_095_00006.1.10.256Aquca_095_00006.2.10.256
Aquca_095_00006.2.10.256Aquca_095_00006.1.267.395Aquca_718_00001.1Aquca_060_00040.3Aquca_095_00006.2.267.381
Aquca_095_00006.2.267.381Aquca_060_00040.2Aquca_060_00040.1
Arabidopsis lyrata490368879948912013
Arabidopsis thalianaAT1G16570.1AT1G16570.2
Brachypodium distachyonBradi1g72620.1
Brassica rapaBra026714Bra026039
Carica papayaevm.model.supercontig_132.61
Capsella rubellaCarubv10009200mCarubv10008948m
Chlamydomonas reinhardtiiCre12.g516550.t1.2
Citrus clementinaCiclev10001033mCiclev10001025mCiclev10001005m
Citrus sinensisorange1.1g015058morange1.1g014316morange1.1g011690morange1.1g011969morange1.1g011979m
Cucumis sativusCucsa.034380.1
Eucalyptus grandisEucgr.F01412.2Eucgr.F01412.1
Fragaria vescamrna02356.1-v1.0-hybrid
Glycine maxGlyma15g40830.1Glyma15g40830.2Glyma08g18130.2
Gossypium raimondiiGorai.007G217600.1Gorai.007G217900.6Gorai.007G217900.3.324.433Gorai.007G217900.3.13.332Gorai.007G217900.7
Gorai.007G217900.3.13.332Gorai.006G005600.3.168.254Gorai.006G005600.3.168.254Gorai.007G217900.3.324.433Gorai.007G217900.5.326.428
Gorai.007G217900.5.326.428Gorai.006G005600.2.168.254Gorai.006G005600.2.168.254Gorai.006G005600.1.168.319Gorai.007G217900.4
Gorai.006G005600.1.168.319Gorai.007G217900.1Gorai.007G217900.2
Linum usitatissimumLus10031569.147.292Lus10031569.147.292Lus10026065Lus10014357
Malus domesticaMDP0000161006.80.246MDP0000159170MDP0000159220MDP0000161006.80.246MDP0000161006.247.440
MDP0000161006.247.440
Manihot esculentacassava4.1_013829mcassava4.1_014658mcassava4.1_016683mcassava4.1_016689m
Medicago truncatulaMedtr2g069330.1
Mimulus guttatusmgv1a005765m
Oryza sativaLOC_Os03g08300.2LOC_Os03g08300.1LOC_Os06g36890.1
Panicum virgatumPavirv00056539mPavirv00038448m
Physcomitrella patensPp1s12_194V6.1
Phaseolus vulgarisPhvul.005G057900.1
Picea abiesMA_179056g0010
Populus trichocarpaPotri.001G394300.4Potri.001G394300.1Potri.001G394300.2Potri.001G394300.3
Prunus persicappa006637mppa005066mppa005033m
Ricinus communis27893.m000222
Setaria italicaSi035510m
Selaginella moellendorffii82712
Sorghum bicolorSb01g045200.1
Thellungiella halophilaThhalv10007520mThhalv10007572m
Vitis viniferaGSVIVT01009332001
Volvox carteriVocar20014254m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)