y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G011500.1
FamilyGT35
Protein PropertiesLength: 992 Molecular Weight: 112130 Isoelectric Point: 6.8397
ChromosomeChromosome/Scaffold: 06 Start: 2483587 End: 2492927
DescriptionGlycosyl transferase, family 35
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT355839860
  PKLVRMANLCVVGGHAVNGVAAIHSEIVKDEVFNDFFQLKFWQLWPEKFQNKTNGVTPRRWIRFCNPELSKIITRWTGSEDWVLNTEKLSELRKFADNED
  LQIQWRAAKRSNKLKVASLIKERTGYIVSPDSMFDIQVKRIHEYKRQLLNILGIVYRYKKMKEMSASERKKKFVPRVCIFGGKAFATYVQAKRIVKFITD
  VGATVNHDPDIGDLLKVIFVPDYNVSVAELLIPASELSQHISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGEENFFLFGAKAHEIAGLRKER
  AEGKFVPDPRFEEVKKFIKSGVFGSSNYNELLGSLEGNEGFGRADYFLVGKDFPSYIECQEKVDETYKDQKVWTRMSIMNTGGSYNFSSDRTIHEYAREI
  WNIK
GT351805040
  ALSKLGHNLENIASQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYRYGLFKQRITKDGQEEVAENWLEMSNPWEIVRNDVAYPIKFYGKVLTDS
  DGKKHWIGGEDIQAVAYDVPIPGYETKTTINLRLWSTKAPSGDFDLSVFNSGKHTQAAEALYNAEKICYVLYPGDESLEGKILRLKQQYTLCSASLQDII
  ARFERRSGAKVKWDEFPDKVAVQMNDTHPTLCIPELMRILIDVKGLSWNEAWNITQRTVAYTNHTVLPEALEKWSLELMEKLLPRHMEIIEMVDEELIRT
  IVSEHGKADSNLLEKKLKQMRILEN
Full Sequence
Protein Sequence     Length: 992     Download
MATWRYSTMP GGAEAVSSRN AVGRFVDFSH GGGGGRRVIK SDQLMLIRKW QLRPVKRSFS    60
VRNVSSEQQQ KVKDLVTQQQ ESPGSYNPFP PDASSIASSI KYHSEFTPLF SPEKFDPPKA    120
FFATAQSIRD ALIINWNATY DYYERLNVKQ AYYLSMEFLQ GRALLNAIGN LGLTGAYAEA    180
LSKLGHNLEN IASQEPDAAL GNGGLGRLAS CFLDSLATLN YPAWGYGLRY RYGLFKQRIT    240
KDGQEEVAEN WLEMSNPWEI VRNDVAYPIK FYGKVLTDSD GKKHWIGGED IQAVAYDVPI    300
PGYETKTTIN LRLWSTKAPS GDFDLSVFNS GKHTQAAEAL YNAEKICYVL YPGDESLEGK    360
ILRLKQQYTL CSASLQDIIA RFERRSGAKV KWDEFPDKVA VQMNDTHPTL CIPELMRILI    420
DVKGLSWNEA WNITQRTVAY TNHTVLPEAL EKWSLELMEK LLPRHMEIIE MVDEELIRTI    480
VSEHGKADSN LLEKKLKQMR ILENVELPAA FSDLLVKPKK SPVAVPSDEL GESEEEEEAE    540
AEAEAEEEKE EEKLKPAGGK IKSVKEGTQG KKKKIPEPVP EPPKLVRMAN LCVVGGHAVN    600
GVAAIHSEIV KDEVFNDFFQ LKFWQLWPEK FQNKTNGVTP RRWIRFCNPE LSKIITRWTG    660
SEDWVLNTEK LSELRKFADN EDLQIQWRAA KRSNKLKVAS LIKERTGYIV SPDSMFDIQV    720
KRIHEYKRQL LNILGIVYRY KKMKEMSASE RKKKFVPRVC IFGGKAFATY VQAKRIVKFI    780
TDVGATVNHD PDIGDLLKVI FVPDYNVSVA ELLIPASELS QHISTAGMEA SGTSNMKFAM    840
NGCILIGTLD GANVEIREEV GEENFFLFGA KAHEIAGLRK ERAEGKFVPD PRFEEVKKFI    900
KSGVFGSSNY NELLGSLEGN EGFGRADYFL VGKDFPSYIE CQEKVDETYK DQKVWTRMSI    960
MNTGGSYNFS SDRTIHEYAR EIWNIKPVEL P*                                  1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00343Phosphorylase9.0e-140180503324+
cd04300GT1_Glycogen_Phosphorylase0586985405+
cd04300GT1_Glycogen_Phosphorylase097504412+
pfam00343Phosphorylase0586987407+
TIGR02093P_ylase0586985405+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ11757.10599914935alpha-1,4 glucan phosphorylase [Gossypium hirsutum]
RefSeqNP_189578.1019911962glucan phosphorylase, putative [Arabidopsis thaliana]
Swiss-ProtP53536051990441002PHSL_VICFA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic; AltName: Full=Starch phosphorylase L; Flags: Precursor
RefSeqXP_002305367.10539915949predicted protein [Populus trichocarpa]
RefSeqXP_002526085.102099118977glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1z8d_A0584987438830A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB1z8d_A09250324433A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_B0584986402795A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_B014749457395A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_A0584986402795A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7783038731209920
HO7971784065879920
HO6207674085859920
HO6139544085859920
HO77830312531220.000000000000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)