y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G037600.1
FamilyGT92
Protein PropertiesLength: 599 Molecular Weight: 68648.8 Isoelectric Point: 9.9518
ChromosomeChromosome/Scaffold: 06 Start: 10559938 End: 10562297
DescriptionDomain of unknown function (DUF23)
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT923075148.7e-22
  NQARFLKEWVIYHALIGVQRWYIYDNNSDDDTDQVIESLFNAGYNISRHIWPWIKTQEGGFSHCALRAKGSCEWIGFIDVDEFLHLPTGLFLHDVISNLT
  STITSFGNISIGEIRVSCYSFGPSGLKRIPKQGVMVGYTCRLAVPERHKSIVKPEALNSTLINIVHHFHLRDDFRFIDVDRRMMVVNHYKYQVWEVFKQK
  FYRRVATY
Full Sequence
Protein Sequence     Length: 599     Download
MRKFLVVLNW FPKGRKSMRF RSRNYINSWG RFFWFAAFIV STFVLFNGFS YSNFRFLFGE    60
RFEPVLKFAR KTPTANAIVS GEHPVTQILS VRETVLLPDQ VILFLKYPRS ARLFTKEELD    120
CVYLSVHNTS PVPRLKQSPA RVDTEQLGEQ IVRCPSGPRG LLITVGSKSN GVFPAGPTHY    180
WDSLAYEALV DNDNTTVVFV KGLNLRPERV SNASRFECVY GEDFSRLKLV LRSEVLSIAQ    240
EIVRCRTPLI VLNSQKKVNS SVKVSVRIKG GGTLPSIARL GFLSDSGRDP LPTRKPHETC    300
ICTMARNQAR FLKEWVIYHA LIGVQRWYIY DNNSDDDTDQ VIESLFNAGY NISRHIWPWI    360
KTQEGGFSHC ALRAKGSCEW IGFIDVDEFL HLPTGLFLHD VISNLTSTIT SFGNISIGEI    420
RVSCYSFGPS GLKRIPKQGV MVGYTCRLAV PERHKSIVKP EALNSTLINI VHHFHLRDDF    480
RFIDVDRRMM VVNHYKYQVW EVFKQKFYRR VATYVADWKD EQNVRSKDRA PGLGTRAVEP    540
VDWSSRFCEV TDTGLKDRVL RNFANPKNSL LPWQTTTNKK AGTWFVEEEN TNKVQEKE*     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00761Glyco_tranf_GTA_type8.0e-530139193+
pfam13704Glyco_tranf_2_44.0e-1230639591+
pfam01697Glyco_transf_924.0e-39295548275+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI17696.10357421579unnamed protein product [Vitis vinifera]
RefSeqNP_198888.107457453550unknown protein [Arabidopsis thaliana]
RefSeqXP_002270991.10185741546PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300081.10185741552predicted protein [Populus trichocarpa]
RefSeqXP_002526930.10185741551ubiquitin-protein ligase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2951
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EY6620792693035710
GO8657763132705730
DY3787372963045980
DR8084582802955730
DT7376322623135740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00172.1Aquca_002_00375.1
Arabidopsis lyrata493908484521
Arabidopsis thalianaAT5G40720.1
Brachypodium distachyonBradi3g14080.1
Brassica rapaBra028472Bra025268
Carica papayaevm.model.supercontig_5.316
Citrus clementinaCiclev10030976m
Citrus sinensisorange1.1g043544morange1.1g037991m
Cucumis sativusCucsa.136130.1
Eucalyptus grandisEucgr.B03384.1
Glycine maxGlyma02g03040.1Glyma01g04515.1Glyma08g40440.1
Gossypium raimondiiGorai.009G345800.1
Manihot esculentacassava4.1_034265mcassava4.1_007462m
Mimulus guttatusmgv1a001120mmgv1a003136m
Panicum virgatumPavirv00056779m
Phaseolus vulgarisPhvul.008G147000.1Phvul.002G078300.1
Ricinus communis29736.m002092
Selaginella moellendorffii102746
Sorghum bicolorSb07g002140.1
Vitis viniferaGSVIVT01003965001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny