y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G038400.1
FamilyCE10
Protein PropertiesLength: 446 Molecular Weight: 49447.7 Isoelectric Point: 8.0154
ChromosomeChromosome/Scaffold: 06 Start: 10691050 End: 10695426
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101114340
  APSDTGTPRHDSRRSSLDGLNSRSDNNVYRGYSPQPQKCRKLPIMLQFHGGGWVSGSNESVANDFFCRRIAKLCDVIVVAVGYRLAPENKYPAAFDDGLK
  VLNWLGKQANLAECCKSMGSGARGVGAEFTKAEVQRHIVDAFGASMVEPWLAAHGDPSRCVLLGVSCGANIADYVACKAIEAGKRLDPVKVVAQVLMYPF
  FIGSIPTKSETRLANSYFYDMPMCLLAWKLFLPAEKFSLDHPAGNPLILDRSLKRMPPTLTIVAEHDWMRDRAIAYSEALRNVNVDAPVLEYKDAVHEFA
  TLDMLLKTPQAQACAEDIAIWVKK
Full Sequence
Protein Sequence     Length: 446     Download
MPSVAVKLYS VFFKFLLKQR LQSWIQDPID ESSNPYGVTT RPEESVSAPN PCFTDGVATK    60
DIHIDPFTAL CIRIFLPESS LSPPEQSHPK SHLRSSLLDP NSINHRRNSY APSDTGTPRH    120
DSRRSSLDGL NSRSDNNVYR GYSPQPQKCR KLPIMLQFHG GGWVSGSNES VANDFFCRRI    180
AKLCDVIVVA VGYRLAPENK YPAAFDDGLK VLNWLGKQAN LAECCKSMGS GARGVGAEFT    240
KAEVQRHIVD AFGASMVEPW LAAHGDPSRC VLLGVSCGAN IADYVACKAI EAGKRLDPVK    300
VVAQVLMYPF FIGSIPTKSE TRLANSYFYD MPMCLLAWKL FLPAEKFSLD HPAGNPLILD    360
RSLKRMPPTL TIVAEHDWMR DRAIAYSEAL RNVNVDAPVL EYKDAVHEFA TLDMLLKTPQ    420
AQACAEDIAI WVKKYISFRG NELSY*                                         480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10162PRK101622.0e-514022081+
pfam00135COesterase7.0e-7137284166+
cd00312Esterase_lipase3.0e-7137279152+
COG0657Aes2.0e-37134429297+
pfam07859Abhydrolase_35.0e-60155410256+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB89022.1014311450CXE carboxylesterase [Actinidia deliciosa]
RefSeqNP_189367.1014451460hydrolase [Arabidopsis thaliana]
RefSeqXP_002267088.1014451464PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002267130.1014451425PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002526925.1014451472conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ed1_F3e-30152412112330B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3ed1_E3e-30152412112330B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3ed1_D3e-30152412112330B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3ed1_C3e-30152412112330B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3ed1_B3e-30152412112330B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES789976368944460
DT555368265903530
JK5155042681814460
EB4388452791704460
DT555368273553791.1
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1Bradi4g39410.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Fragaria vescamrna28030.1-v1.0-hybrid
Glycine maxGlyma19g24390.1Glyma16g06780.1Glyma05g06430.1Glyma19g22760.1
Gossypium raimondiiGorai.007G074300.2Gorai.012G091000.1Gorai.002G190500.1Gorai.001G268100.1Gorai.011G093200.1
Gorai.007G074300.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1Phvul.008G149400.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny