y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G080700.1
FamilyGH1
Protein PropertiesLength: 645 Molecular Weight: 73044.3 Isoelectric Point: 6.4378
ChromosomeChromosome/Scaffold: 06 Start: 30807610 End: 30813058
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1625400
  DGFFFGLATAPAHVEDKLNDAWLQFAEENPCHKSEKGDDDMMEADAVIGAADGGSHQAPLARKESSKKKKPLKVAMEAMIRGLQKFVEDESEEETASKEE
  CNHNVAAWHNVPHPEERLKFWSDPDIELNLAKDTGISIFRMGIDWSQIMPQEPVNGIKDAVNFAALERYKWIISRVRSNGMKVMLTLFHHSLPPWAGDYG
  GWKLEKTVDYFMDFTKLVVNSVSDMVDYWITFNEPHVFCMLTYSAGAWPGGHPDMIEAATSALPTGVFRQALHWMAIAHSKAYDYIHEQSSTLSKKVVGV
  AHNVSFTRPYGLFDVAAVTLANSLTLFPYVDSICDKLDFIGINYYGQEVISGAGLKLVETDEYSESGRGVYPGGLFRLLIDFHERYKHLKVPFIITENGI
  ADETDVIRRPYLLEHLLAVYAAMLKGVPVLGYLFWTISDNWEWADGYGPKFGLVAVDRANGLVRIPRPSYYLFTKVVTT
Full Sequence
Protein Sequence     Length: 645     Download
MAFAALFISA TKLAGIIMTV SIAANAFSFS RYRKKHLRRF DSPIVESSDT LADFNVNGEE    60
EDGFFFGLAT APAHVEDKLN DAWLQFAEEN PCHKSEKGDD DMMEADAVIG AADGGSHQAP    120
LARKESSKKK KPLKVAMEAM IRGLQKFVED ESEEETASKE ECNHNVAAWH NVPHPEERLK    180
FWSDPDIELN LAKDTGISIF RMGIDWSQIM PQEPVNGIKD AVNFAALERY KWIISRVRSN    240
GMKVMLTLFH HSLPPWAGDY GGWKLEKTVD YFMDFTKLVV NSVSDMVDYW ITFNEPHVFC    300
MLTYSAGAWP GGHPDMIEAA TSALPTGVFR QALHWMAIAH SKAYDYIHEQ SSTLSKKVVG    360
VAHNVSFTRP YGLFDVAAVT LANSLTLFPY VDSICDKLDF IGINYYGQEV ISGAGLKLVE    420
TDEYSESGRG VYPGGLFRLL IDFHERYKHL KVPFIITENG IADETDVIRR PYLLEHLLAV    480
YAAMLKGVPV LGYLFWTISD NWEWADGYGP KFGLVAVDRA NGLVRIPRPS YYLFTKVVTT    540
GKITREDREK AWNELQKAAK EKQTRPFYRE VNKQGLMYAG GLDEPTQRPF IERDWRFGHY    600
EMEGLQDPLS RLSRYLLRPF SLRKKRKHKK VNSELVLEPL ELSA*                    660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01233lacG5.0e-21175518417+
PRK13511PRK135116.0e-27181543439+
pfam00232Glyco_hydro_12.0e-55189540408+
TIGR03356BGL1.0e-56186534392+
COG2723BglB7.0e-64175544426+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ87636.1016411636putative beta-glycosidase [Glycine max]
EMBLCAJ87637.1016401638putative beta-glycosidase [Solanum lycopersicum]
EMBLCBI22845.1016431618unnamed protein product [Vitis vinifera]
RefSeqXP_002280268.1016431647PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316058.1016391611predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ha4_A2.00386e-4315154618471A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB4ha3_A2.00386e-4315154618471A Chain A, Structure Of Beta-Glycosidase From Acidilobus Saccharovorans In Complex With Tris
PDB3apg_D6e-4017554652460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_C6e-4017554652460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_B6e-4017554652460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
Transmembrane Domains
StartEnd
527
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0996752703366050
GO8410083242025250
CX0459473052785820
GO8544993342095380
GO8579233022195200
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00022.2Aquca_073_00022.1Aquca_073_00022.3Aquca_073_00022.4
Arabidopsis lyrata477956
Arabidopsis thalianaAT3G06510.1AT3G06510.2
Brachypodium distachyonBradi4g09920.1
Brassica rapaBra040275Bra029584
Capsella rubellaCarubv10013225m
Citrus clementinaCiclev10004508mCiclev10004510mCiclev10004513mCiclev10004514mCiclev10004507m
Ciclev10004684m
Citrus sinensisorange1.1g008043m.64.291orange1.1g008043m.327.475orange1.1g008043m.327.475orange1.1g008043m.64.291orange1.1g008982m
orange1.1g006266morange1.1g006265morange1.1g006252morange1.1g006261morange1.1g011240m
orange1.1g008980m
Cucumis sativusCucsa.246950.2Cucsa.246950.1
Eucalyptus grandisEucgr.H04080.1Eucgr.H04080.2
Fragaria vescamrna05024.1-v1.0-hybrid
Glycine maxGlyma07g36470.2Glyma05g06465.1Glyma17g04130.1
Gossypium raimondiiGorai.006G080700.2
Linum usitatissimumLus10043048Lus10011147
Malus domesticaMDP0000187687
Manihot esculentacassava4.1_003404m
Mimulus guttatusmgv1a023966m
Oryza sativaLOC_Os11g45710.1LOC_Os11g45710.2LOC_Os11g45710.3LOC_Os11g45710.4LOC_Os11g45710.5
LOC_Os11g45710.6LOC_Os11g45710.7
Panicum virgatumPavirv00063330mPavirv00063329mPavirv00005855m
Physcomitrella patensPp1s37_35V6.1Pp1s25_336V6.1
Phaseolus vulgarisPhvul.003G118100.1Phvul.003G118100.2
Picea abiesMA_36535g0010MA_10436797g0010MA_194231g0010MA_10111401g0010MA_7936147g0010
Populus trichocarpaPotri.010G149500.3Potri.010G149500.1Potri.010G149500.2
Prunus persicappa002585m
Ricinus communis29889.m003347.69.28529889.m003347.319.46729889.m003347.319.46729889.m003347.69.285
Setaria italicaSi026098mSi026096m
Selaginella moellendorffii110274935
Sorghum bicolorSb05g026810.3Sb05g026810.2Sb05g026810.1
Thellungiella halophilaThhalv10020302m
Vitis viniferaGSVIVT01034947001
Zea maysAC148152.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny