y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G087900.5
FamilyCBM57
Protein PropertiesLength: 498 Molecular Weight: 54771.3 Isoelectric Point: 7.4337
ChromosomeChromosome/Scaffold: 06 Start: 32287790 End: 32293708
Descriptionreceptor like protein 4
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572103595.3e-25
  DYSGDHWGGDRFWHPIRTFGKNVDAPRSTESGIKKASTVPNFYPEALYQSAVVSTDSKPDLAYTMDVDPNKNYSIWLHFAEIDATITSAGKRVFDVLING
  GTVFENVDVVGMSGDRYTALVLNTTVALSGRTLTITLHPKKGNHAILTAI
Full Sequence
Protein Sequence     Length: 498     Download
MLRFTLLWLL VFLFASISSS SARPAPYAMR ISCGARQNIR TPPTYTRWYK DFAYTGGIPA    60
NATAPSHITP PLKTLRYFPL SEGPENCYII NRVPKGHYSV RIFFGLVEHE IDNEPLFEVS    120
VEGTIIHSLK SGWSKNDEQV FAEALVFLLD GSVSICFHST GRGDPTIISI EILQIDEKAY    180
YFGPEWGRGV ILKTTSRLTC GTSKPKFDED YSGDHWGGDR FWHPIRTFGK NVDAPRSTES    240
GIKKASTVPN FYPEALYQSA VVSTDSKPDL AYTMDVDPNK NYSIWLHFAE IDATITSAGK    300
RVFDVLINGG TVFENVDVVG MSGDRYTALV LNTTVALSGR TLTITLHPKK GNHAILTAIE    360
VFQVIVAESK TSPEEVRALQ ALKKSLGLPN RFGWNGDPCV PKEHPWSGAD CHFDKSGGKW    420
FIDGLGLGNQ GLRGSLPNEI SKLHHLQSIN LSGNSIHGVI PSSLGTVTSL ETLDLSYNFL    480
NGSIPESLGK LTALRRL*                                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001132.0e-1042549773+
pfam11721Malectin3.0e-15200346150+
pfam12819Malectin_like1.0e-5931364350+
PLN03150PLN03150022497477+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF16758.102249722498AC010155_11 F3M18.23 [Arabidopsis thaliana]
EMBLCBI30598.102549723497unnamed protein product [Vitis vinifera]
RefSeqNP_174156.102249722498AtRLP4 (Receptor Like Protein 4); protein binding [Arabidopsis thaliana]
RefSeqXP_002305781.10294971470predicted protein [Populus trichocarpa]
RefSeqXP_002509445.1014971503serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rgz_A0.0000003413497628709A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB3rgz_A0.000005425486661722A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB3rgz_A0.00001425497399471A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB3rgz_A0.00002425490495560A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB3rgz_A0.0001444497394447A Chain A, The Crystal Structure Of Arabinofuranosidase
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8507122761874580
EX133552277222970
HO8091751812254050
HO809175179512280
DW493037204152180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.4Gorai.006G087900.3
Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)