y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G090800.1
FamilyGT68
Protein PropertiesLength: 522 Molecular Weight: 59149.2 Isoelectric Point: 7.9666
ChromosomeChromosome/Scaffold: 06 Start: 32715908 End: 32719985
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT682014960
  LNRVLVIPGSKFDYQYNLVLDIEHINECIGRKTVISFKNFMELKKNHARIDKFICYFSIPLPCYTDEDHLKQLKSLGISMGKVETAWKSEDIENPSPKTV
  KDVEEKFGTKEDVIAIGDVFFANVEKDWVLQPRGPIAHKCKILIEPSKLILLTAQRFIQTFLGSGFVALHFRRHGFLKFCNAKKPSCFYPIPQAADCIRQ
  MVEKANTSVIYLSTDAAESETSLLQSMLVMNGKTIPLVKRPPRDSAEKWDSLLYRHGLDGDDQVEAMLDKTICAMASVFIGAPGSTFTEDILRLRK
Full Sequence
Protein Sequence     Length: 522     Download
MARDSPNEDD DHENLIHQNK DKSASFRIEE LQSPIRRRFS KGHYLFAAIV TVISLVATIY    60
LFFSSKICGT TSDRIKESQL RALYLLNKQR SSLFDLWNHT FGTSNNITAV RFDQIKASLL    120
DQITLNRHIK DTLLSTENGT VSVPIVNGSE ICLKIDPKSS KRRTIEWKPD PNKFLFAICL    180
SGQMSNHLIC LEKHMFFAAV LNRVLVIPGS KFDYQYNLVL DIEHINECIG RKTVISFKNF    240
MELKKNHARI DKFICYFSIP LPCYTDEDHL KQLKSLGISM GKVETAWKSE DIENPSPKTV    300
KDVEEKFGTK EDVIAIGDVF FANVEKDWVL QPRGPIAHKC KILIEPSKLI LLTAQRFIQT    360
FLGSGFVALH FRRHGFLKFC NAKKPSCFYP IPQAADCIRQ MVEKANTSVI YLSTDAAESE    420
TSLLQSMLVM NGKTIPLVKR PPRDSAEKWD SLLYRHGLDG DDQVEAMLDK TICAMASVFI    480
GAPGSTFTED ILRLRKGWET ASSCDEYLCH GEEPNFIASD K*                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11548NodZ_like0.005343497159+
cd11296O-FucT_like0.000317420835+
pfam10250O-FucT2.0e-7197488326+
cd11298O-FucT-27.0e-9362488129+
cd11296O-FucT_like1.0e-18333495181+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD50008.1015211594AC007651_3 Hypothetical Protein [Arabidopsis thaliana]
RefSeqNP_173170.2015211564unknown protein [Arabidopsis thaliana]
RefSeqNP_199853.1015211566unknown protein [Arabidopsis thaliana]
RefSeqXP_002264087.1015211559PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303337.1015211527predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ap6_D0.0007362488277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_C0.0007362488277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_B0.0007362488277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_A0.0007362488277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap5_B0.0008362488263369A Chain A, Crystal Structure Of Human Pofut2
Transmembrane Domains
StartEnd
4264
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO11383427312730
ES8502683331624920
CO0852392862195040
GO8818723521695180
ES850268524685171.8
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00900.1Aquca_013_00900.2
Arabidopsis lyrata918074889130474511
Arabidopsis thalianaAT5G50420.1AT1G17270.1AT1G53770.2AT1G53770.1
Brachypodium distachyonBradi1g23980.1
Brassica rapaBra039691Bra016609Bra022515
Carica papayaevm.model.supercontig_25.202
Capsella rubellaCarubv10008736mCarubv10026161mCarubv10008696m
Citrus clementinaCiclev10025289m
Citrus sinensisorange1.1g008526m
Cucumis sativusCucsa.088930.1Cucsa.149140.2Cucsa.088930.2Cucsa.149140.1
Eucalyptus grandisEucgr.J02587.1Eucgr.I02168.1
Fragaria vescamrna05486.1-v1.0-hybrid
Glycine maxGlyma16g01730.1Glyma07g05200.1
Gossypium raimondiiGorai.010G172800.1Gorai.011G054400.1
Linum usitatissimumLus10037461Lus10003929
Malus domesticaMDP0000692823MDP0000881647MDP0000203531
Manihot esculentacassava4.1_004684m
Medicago truncatulaMedtr8g023490.1
Mimulus guttatusmgv1a003863m
Oryza sativaLOC_Os07g38490.1
Panicum virgatumPavirv00005372mPavirv00007596m
Physcomitrella patensPp1s149_19V6.1
Phaseolus vulgarisPhvul.010G122400.1Phvul.009G261000.1
Picea abiesMA_10437033g0010
Populus trichocarpaPotri.003G073500.5Potri.003G073500.1Potri.003G073500.2Potri.003G073500.3Potri.003G073500.4
Potri.003G073500.6
Prunus persicappa004150m
Ricinus communis29884.m000188
Setaria italicaSi029376m
Selaginella moellendorffii146424410382
Sorghum bicolorSb02g037060.1
Thellungiella halophilaThhalv10013133mThhalv10007186mThhalv10011359m
Vitis viniferaGSVIVT01016658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny