y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G094700.1
FamilyGT20
Protein PropertiesLength: 945 Molecular Weight: 107045 Isoelectric Point: 5.8667
ChromosomeChromosome/Scaffold: 06 Start: 33233993 End: 33241011
Descriptiontrehalose-6-phosphate synthase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT201125830
  SKQRLLVVANRLPVSAVRHGEDSWQLEMSVGGLVTALLGVKEFDTRWIGWAGVNVPDEIGQKALAKALDEKLMQRCIPVFLDEEVVHQYYNGYCNNILWP
  LFHYIGLPQEDRLATTRSFQSQFDAYKKANQLFADVVNEHYEEGDVVWCHDYHLMFLPKCLKERNSKMKVGWFLHTPFPSSEIHRMLPSRLELLRSVLAA
  DLVGFHTYDYARHFVSACTRILGLEGTPEGVEDQGKLTRIAAFPVGIDSERFIKALELPEVQDHMKVLKQRFAGRKVMLGVDRLDMIKGIPQKILAFEKF
  LEENPNWCNKVVLLQIAVPTRTDVPEYQKLTSQVHEIVGRINGRFGSLTAVPIHHLDRSLDFHELCALYAVTDVALVTSLRDGMNLVSYEYVACQESKKG
  VLILSEFAGAAQSLGAGAILVNPWNVTEVASSIGYALNMPADEREKRHHHNFKHVISHTAQEWAATFVSELN
Full Sequence
Protein Sequence     Length: 945     Download
MSISSQEICI LPNKNNLALL QTNGMPGNLY NNCSNLPATP TRLERLLRER ELRKYSKCLN    60
DCEAELPSST QDCFSPDLET STCWFNDEEL LETVSASRSL NDDGERLDFR TSKQRLLVVA    120
NRLPVSAVRH GEDSWQLEMS VGGLVTALLG VKEFDTRWIG WAGVNVPDEI GQKALAKALD    180
EKLMQRCIPV FLDEEVVHQY YNGYCNNILW PLFHYIGLPQ EDRLATTRSF QSQFDAYKKA    240
NQLFADVVNE HYEEGDVVWC HDYHLMFLPK CLKERNSKMK VGWFLHTPFP SSEIHRMLPS    300
RLELLRSVLA ADLVGFHTYD YARHFVSACT RILGLEGTPE GVEDQGKLTR IAAFPVGIDS    360
ERFIKALELP EVQDHMKVLK QRFAGRKVML GVDRLDMIKG IPQKILAFEK FLEENPNWCN    420
KVVLLQIAVP TRTDVPEYQK LTSQVHEIVG RINGRFGSLT AVPIHHLDRS LDFHELCALY    480
AVTDVALVTS LRDGMNLVSY EYVACQESKK GVLILSEFAG AAQSLGAGAI LVNPWNVTEV    540
ASSIGYALNM PADEREKRHH HNFKHVISHT AQEWAATFVS ELNVTIVEAQ LRTRQIPPPL    600
PIEVAVDRYS CLNNRLLILG FNATLTEPVD TLGRKDSQIN EWEPKLRPDL REPLRKLCDD    660
PKTTVLVLSG SARNVLDDNF SDYNLWLAAE NGMFLRVTTG DWMTTMPENL SMEWVDSVKN    720
VFEYFTDRTP RSQFEVRETS LIWNYKYSDV EFGRLQARDL LQHLWTGPIS NASLDVVQGR    780
RSVEVRSVAV TKGAAIDRIL GEIVHNKGMK EPIDYVLCIG HFLTKDEDIY TFFEPELPSE    840
VPASVRPQVP TQVRTSIVGS RAALLMKQNS MSAVEQNKSY AIDGDTLHSM VTDRISLQEG    900
SSVLDLQAND YFSCSVARKR SNSRYRLQSS DEVVTLLREL ADHR*                    960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03064PLN03064025942932+
PLN03063PLN030630108943836+
TIGR02400trehalose_OtsA0115583470+
pfam00982Glyco_transf_200114583475+
PRK14501PRK145010115830722+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005992trehalose biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAA69879.10259421937trehalose-6-phosphate synthase [Arabidopsis thaliana]
RefSeqNP_177979.10259421937ATTPS1 (TREHALOSE-6-PHOSPHATE SYNTHASE); alpha,alpha-trehalose-phosphate synthase (UDP-forming)/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002305707.10479441896predicted protein [Populus trichocarpa]
RefSeqXP_002522296.10259421910trehalose-6-phosphate synthase, putative [Ricinus communis]
RefSeqXP_002531237.10259411920trehalose-6-phosphate synthase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wtx_D01155943466A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase
PDB2wtx_C01155943466A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase
PDB2wtx_B01155943466A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase
PDB2wtx_A01155943466A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase
PDB1uqu_B01155943466A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX5467633081014070
ES8133753614798390
DW0699102882044910
CV7113072971124080
CB6511332831424240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00517.2Aquca_005_00517.1Aquca_039_00035.4Aquca_039_00035.3Aquca_039_00035.2
Aquca_039_00035.1Aquca_002_00251.3Aquca_002_00251.2Aquca_002_00251.1Aquca_002_01274.1
Aquca_025_00274.3Aquca_025_00274.2Aquca_025_00274.1Aquca_136_00003.6Aquca_136_00003.5
Aquca_136_00003.4Aquca_136_00003.3Aquca_136_00003.2Aquca_136_00003.1Aquca_126_00003.7
Aquca_126_00003.6Aquca_126_00003.5Aquca_126_00003.4Aquca_126_00003.3Aquca_136_00003.7
Aquca_126_00003.2Aquca_126_00003.1Aquca_010_00468.2
Arabidopsis lyrata329750876862470660889930894829
893529875216312668477022857882
Arabidopsis thalianaAT4G17770.1AT1G68020.2AT1G68020.1AT1G06410.1AT1G23870.1
AT1G70290.1AT1G60140.1AT2G18700.1AT1G78580.1AT1G16980.1
AT1G17000.1AT4G27550.1
Brachypodium distachyonBradi4g29730.1Bradi1g69420.2Bradi1g69420.1Bradi4g41580.1Bradi2g19710.1
Bradi2g49870.1Bradi3g35820.2Bradi3g35820.1Bradi3g53790.2Bradi3g53790.1
Bradi3g37200.1Bradi2g19640.1
Brassica rapaBra012642Bra030651Bra016328Bra004054Bra007906
Bra031526Bra017888Bra038548Bra035049Bra026011
Bra019043Bra008366Bra026010Bra015497
Carica papayaevm.model.supercontig_124.34evm.model.supercontig_2.171evm.model.supercontig_7.119evm.model.supercontig_90.21evm.model.supercontig_2573.1
evm.model.supercontig_77.64evm.model.supercontig_17.166evm.model.supercontig_17.165
Capsella rubellaCarubv10004115mCarubv10008294mCarubv10008292mCarubv10019781mCarubv10008281m
Carubv10008279mCarubv10019802mCarubv10019782mCarubv10012956mCarubv10019735m
Carubv10012173mCarubv10004177m
Chlamydomonas reinhardtiig6363.t1Cre16.g686200.t1.3Cre16.g662350.t1.3
Citrus clementinaCiclev10000377mCiclev10000249mCiclev10000248mCiclev10000247mCiclev10000246m
Ciclev10014248mCiclev10014247mCiclev10014252mCiclev10014251mCiclev10018842m
Ciclev10030692mCiclev10030691mCiclev10007549mCiclev10007428mCiclev10018748m
Ciclev10017787m.78.348Ciclev10017787m.78.348Ciclev10017787m.351.497Ciclev10017787m.351.497
Citrus sinensisorange1.1g002958morange1.1g002956morange1.1g002955morange1.1g002954morange1.1g002952m
orange1.1g002951morange1.1g002949morange1.1g002947morange1.1g003682morange1.1g004314m
orange1.1g003026morange1.1g003025morange1.1g003024morange1.1g003022morange1.1g045882m
orange1.1g044635morange1.1g003999morange1.1g002986morange1.1g002984morange1.1g002983m
orange1.1g002979morange1.1g002977morange1.1g004512morange1.1g004411morange1.1g003042m
orange1.1g002285morange1.1g005855morange1.1g003145morange1.1g003029morange1.1g002314m
orange1.1g003508morange1.1g002468m
Cucumis sativusCucsa.321970.2Cucsa.321970.1Cucsa.195700.1Cucsa.285920.3Cucsa.285920.2
Cucsa.285920.1Cucsa.047130.2Cucsa.047130.1Cucsa.197030.2Cucsa.197030.1
Cucsa.212680.2Cucsa.212680.1Cucsa.057970.2Cucsa.057970.1
Eucalyptus grandisEucgr.E00259.3Eucgr.E00259.2Eucgr.E00259.1Eucgr.D00465.1Eucgr.B02686.1
Eucgr.A01931.1Eucgr.B03950.2Eucgr.B03950.1Eucgr.B00354.1Eucgr.C00201.1
Eucgr.G02474.1Eucgr.F03232.1
Fragaria vescamrna14043.1-v1.0-hybridmrna29717.1-v1.0-hybridmrna32162.1-v1.0-hybridmrna00676.1-v1.0-hybridmrna15859.1-v1.0-hybrid
mrna04965.1-v1.0-hybridmrna27346.1-v1.0-hybridmrna24860.1-v1.0-hybrid.87.409mrna24860.1-v1.0-hybrid.87.409mrna15723.1-v1.0-hybrid
mrna24860.1-v1.0-hybrid.440.585mrna24860.1-v1.0-hybrid.440.585
Glycine maxGlyma20g25540.4Glyma20g25540.3Glyma10g41680.4Glyma10g41680.3Glyma10g41680.2
Glyma08g39870.1Glyma18g18590.1Glyma01g03870.3Glyma01g03870.2Glyma02g09480.1
Glyma02g03820.1Glyma07g26980.2Glyma06g42820.1Glyma12g15500.1Glyma17g07530.2
Glyma17g07530.1Glyma05g02020.3Glyma05g02020.2Glyma06g19590.1Glyma04g35190.5
Glyma04g35190.4Glyma04g35190.3Glyma04g35190.2Glyma13g01420.1Glyma13g33970.2
Glyma13g33970.1Glyma12g36280.3Glyma12g36280.2Glyma12g36280.1Glyma15g27480.4
Glyma15g27480.3Glyma15g27480.2Glyma08g12760.1Glyma05g29651.1Glyma12g36280.4
Gossypium raimondiiGorai.007G033200.3Gorai.007G033200.2Gorai.007G033200.1Gorai.004G183400.3Gorai.004G183400.2
Gorai.004G183400.1Gorai.009G160400.1Gorai.005G183800.4Gorai.005G183800.3Gorai.005G183800.2
Gorai.005G183800.1Gorai.011G037000.2Gorai.011G037000.1Gorai.001G070500.2Gorai.001G070500.1
Gorai.005G152400.4Gorai.005G152400.3Gorai.005G152400.2Gorai.005G152400.1Gorai.010G241200.3
Gorai.010G241200.2Gorai.010G241200.1Gorai.004G103500.3Gorai.004G103500.2Gorai.004G103500.1
Gorai.006G094700.5Gorai.006G094700.3Gorai.006G094700.2Gorai.009G159000.2Gorai.009G159000.1
Gorai.002G046400.7Gorai.002G046400.6Gorai.002G046400.4Gorai.002G046400.3Gorai.002G046400.2
Gorai.002G046400.1Gorai.006G094700.4Gorai.009G362600.3Gorai.009G362600.2Gorai.009G362600.1
Gorai.002G046400.5Gorai.006G094700.7Gorai.006G094500.2Gorai.006G094500.1Gorai.006G094700.6
Linum usitatissimumLus10034585Lus10005425Lus10030853Lus10021805Lus10030635
Lus10015231Lus10007311Lus10012990Lus10029258Lus10029175
Lus10020741Lus10029821Lus10015509Lus10019982Lus10013694
Lus10005559Lus10015243Lus10005412
Malus domesticaMDP0000265728MDP0000838058MDP0000278633MDP0000913703MDP0000258781
MDP0000135837MDP0000799020MDP0000856196MDP0000257194MDP0000919905
MDP0000125204MDP0000139096MDP0000267875MDP0000372287MDP0000227381.89.322
MDP0000227381.89.322MDP0000227381.319.514MDP0000227381.319.514
Manihot esculentacassava4.1_001558mcassava4.1_001584mcassava4.1_001583mcassava4.1_001537mcassava4.1_001541m
cassava4.1_001591mcassava4.1_002572mcassava4.1_001596mcassava4.1_001575mcassava4.1_001517m
cassava4.1_029065mcassava4.1_021281mcassava4.1_023440mcassava4.1_001223mcassava4.1_001215m
Medicago truncatulaMedtr8g105740.1Medtr4g080160.1Medtr4g129270.1Medtr8g087910.1Medtr8g087930.1
Medtr3g076810.1
Mimulus guttatusmgv1a001209mmgv1a001235mmgv1a001234mmgv1a001255mmgv1a001271m
mgv1a001183mmgv1a001197mmgv1a001670mmgv1a001200mmgv1a001031m
mgv1a000968mmgv1a002429m
Oryza sativaLOC_Os09g23350.1LOC_Os03g12360.2LOC_Os03g12360.1LOC_Os01g53000.2LOC_Os01g53000.1
LOC_Os05g44100.1LOC_Os01g54560.2LOC_Os01g54560.1LOC_Os08g31980.1LOC_Os09g20990.1
LOC_Os01g54560.3LOC_Os02g54820.3LOC_Os02g54820.2LOC_Os02g54820.1LOC_Os08g34580.2
LOC_Os08g34580.1LOC_Os09g25890.2LOC_Os09g25890.1LOC_Os05g44210.1
Panicum virgatumPavirv00067539mPavirv00066372mPavirv00044795mPavirv00024392mPavirv00047036m
Pavirv00020834mPavirv00063462mPavirv00028869mPavirv00028868mPavirv00061089m
Pavirv00022963mPavirv00018213mPavirv00052109mPavirv00018778mPavirv00018777m
Pavirv00042411mPavirv00039659mPavirv00039254mPavirv00047762mPavirv00007139m
Pavirv00063884mPavirv00015685m.50.390Pavirv00015685m.50.390Pavirv00001194mPavirv00063137m
Pavirv00036935mPavirv00048979mPavirv00056127mPavirv00011146mPavirv00015685m.387.510
Pavirv00015685m.387.510
Physcomitrella patensPp1s153_142V6.1Pp1s80_88V6.1Pp1s81_200V6.1Pp1s88_178V6.1Pp1s116_157V6.2
Pp1s116_157V6.1Pp1s240_110V6.3Pp1s240_110V6.2Pp1s240_110V6.1
Phaseolus vulgarisPhvul.007G031800.2Phvul.007G031800.1Phvul.003G053000.1Phvul.003G016300.1Phvul.002G072400.2
Phvul.002G072400.1Phvul.011G127700.2Phvul.011G127700.1Phvul.003G150400.1Phvul.009G180300.1
Phvul.003G198800.1Phvul.011G170300.3Phvul.011G170300.2Phvul.011G170300.1Phvul.002G243600.1
Phvul.005G076500.2Phvul.005G076500.1
Picea abiesMA_48114g0010MA_10432494g0010MA_104187g0020MA_30723g0020.43.336MA_30723g0020.43.336
MA_104187g0010MA_284462g0010MA_747988g0010MA_10436560g0010MA_159003g0170
MA_99899g0010MA_30723g0020.331.462MA_30723g0020.331.462MA_10436997g0010
Populus trichocarpaPotri.003G094500.4Potri.003G094500.3Potri.003G094500.2Potri.003G094500.1Potri.001G139500.3
Potri.001G139500.2Potri.001G139500.1Potri.004G061500.2Potri.004G061500.1Potri.010G104500.2
Potri.010G104500.1Potri.012G078500.1Potri.011G070900.3Potri.011G070900.2Potri.011G070900.1
Potri.008G136500.1Potri.015G074000.1Potri.018G097700.2Potri.018G097700.1Potri.006G175500.1
Potri.004G064600.1Potri.011G103900.2Potri.001G383600.1Potri.011G103900.1Potri.004G064600.2
Prunus persicappa001305mppa001324mppa001556mppa001295mppa001387m
ppa001301mppa001397mppa001048mppa001057m
Ricinus communis30026.m00146930147.m01397829883.m00203628863.m00008830054.m000811.220.492
30054.m000811.220.49229607.m00023230026.m00151029968.m000632.57.26329968.m000632.57.263
29968.m000632.266.45029968.m000632.266.45030054.m000811.57.22130054.m000811.57.221
Setaria italicaSi034520mSi034462mSi034211mSi000238mSi000262m
Si028904mSi028903mSi013243mSi013302mSi013282m
Si016360mSi016303mSi029345mSi029154mSi019524m
Si021103m
Selaginella moellendorffii11782280360184345171410184811
Sorghum bicolorSb02g024140.1Sb01g042380.1Sb03g034640.1Sb03g033590.1Sb09g025660.1
Sb07g020270.1Sb02g023610.1Sb04g035560.1Sb07g021920.1Sb04g001670.1
Sb09g025790.1
Thellungiella halophilaThhalv10024381mThhalv10018111mThhalv10006783mThhalv10006782mThhalv10006780m
Thhalv10006773mThhalv10018114mThhalv10023265mThhalv10022544mThhalv10018081m
Thhalv10009417mThhalv10006809mThhalv10026761m
Vitis viniferaGSVIVT01020754001GSVIVT01021260001GSVIVT01007789001GSVIVT01031857001GSVIVT01020215001.138.377
GSVIVT01020215001.138.377GSVIVT01014092001GSVIVT01013121001GSVIVT01011634001.29.229GSVIVT01011634001.29.229
GSVIVT01021312001GSVIVT01021313001GSVIVT01020215001.31.141GSVIVT01020215001.31.141GSVIVT01011634001.230.392
GSVIVT01011634001.230.392
Volvox carteriVocar20002694m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)