y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G118100.3
FamilyGH3
Protein PropertiesLength: 401 Molecular Weight: 44047.2 Isoelectric Point: 9.5382
ChromosomeChromosome/Scaffold: 06 Start: 36782192 End: 36785281
DescriptionGlycosyl hydrolase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH31063400
  STRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLGVTRDPNLVKRIGEATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDHKIVQMMTEIITGLQG
  GLPVHSKKGVPFVAGKNKVAACAKHYVGDGGTTKGINENNTVISWNGLLGIHMPAYFNSIAKGVATIMTSYSSWNGKKMHANHDLVTDFLKNKLKFRGFV
  ISDWQGLDRITSPPHANYSYSVEAGVGAGIDMVMV
Full Sequence
Protein Sequence     Length: 401     Download
MGKFSIPKLG FLLLCCLAAL TEATYVKYKD PKQPLGVRIK DLMRRMTLAE KIGQMTQIER    60
TVATPDAMKN YFIGSVLSGG GSVPAQKATP ETWIEMVNTM QKASLSTRLG IPMIYGIDAV    120
HGHNNVYKAT IFPHNIGLGV TRDPNLVKRI GEATALEVRA TGIPYVFAPC IAVCRDPRWG    180
RCYESYSEDH KIVQMMTEII TGLQGGLPVH SKKGVPFVAG KNKVAACAKH YVGDGGTTKG    240
INENNTVISW NGLLGIHMPA YFNSIAKGVA TIMTSYSSWN GKKMHANHDL VTDFLKNKLK    300
FRGFVISDWQ GLDRITSPPH ANYSYSVEAG VGAGIDMVMV PYNFTEFIDD LTYQVKNNII    360
PMSRIDDAVK RILRVKFVMG LFENPMADNS LVNQLGSQVC *                        420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03080PLN030808.0e-18103400336+
PRK15098PRK150981.0e-4739385356+
COG1472BglX2.0e-7246390356+
pfam00933Glyco_hydro_35.0e-9447375333+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAQ17461.1013981398beta-D-glucosidase [Gossypium hirsutum]
EMBLCBI24412.1013981401unnamed protein product [Vitis vinifera]
RefSeqXP_002278363.1013981398PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002278377.1013981398PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002523935.1013981403hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1j8v_A0253982375A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB1iex_A0253982375A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB1iew_A0253982375A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB1iev_A0253982375A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB1ieq_A0253982375A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO784016325743980
FN998758328713980
FN998446321713910
FN998735317713870
HO7840165125750.000000000000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00600.1Aquca_009_00598.3Aquca_009_00598.2Aquca_009_00598.1Aquca_009_00603.1
Aquca_009_00596.1Aquca_009_00601.1Aquca_009_00602.1Aquca_009_00735.2Aquca_009_00735.1
Aquca_009_00596.4Aquca_009_00596.3Aquca_009_00596.2Aquca_009_00596.5Aquca_009_00735.3
Aquca_009_00601.2
Arabidopsis lyrata485082489005487274489003485079
323329486769485080
Arabidopsis thalianaAT5G20950.2AT5G20950.1AT5G04885.1AT5G20940.1AT3G47000.1
AT3G47010.2AT3G47010.1AT3G47050.2AT3G47050.1AT3G62710.1
AT3G47040.1AT3G47040.2
Brachypodium distachyonBradi1g08550.2Bradi1g08570.2Bradi1g08570.1Bradi2g51280.1Bradi1g08560.1
Bradi1g08580.1Bradi2g23720.1
Brassica rapaBra005825Bra020139Bra009417Bra003508Bra018177
Bra014397Bra002346Bra018172Bra006587Bra018171
Bra033795
Carica papayaevm.model.supercontig_103.89evm.model.supercontig_51.147evm.model.supercontig_103.88evm.model.supercontig_51.146evm.model.supercontig_103.83
evm.model.supercontig_112.57evm.model.supercontig_103.85
Capsella rubellaCarubv10016857mCarubv10000466mCarubv10000396mCarubv10002603mCarubv10016864m
Carubv10019506mCarubv10016871mCarubv10018993m
Citrus clementinaCiclev10019305mCiclev10030270mCiclev10018271mCiclev10017853mCiclev10015118m
Ciclev10014767mCiclev10014537mCiclev10028019mCiclev10028018mCiclev10028048m
Citrus sinensisorange1.1g038523morange1.1g036635morange1.1g006872morange1.1g013915morange1.1g013894m
orange1.1g013886morange1.1g040637m
Cucumis sativusCucsa.340290.1Cucsa.282900.1Cucsa.111760.1Cucsa.340300.1Cucsa.356980.1
Cucsa.146890.1Cucsa.146880.2Cucsa.146880.1Cucsa.146890.3Cucsa.146890.2
Cucsa.340290.2Cucsa.109190.1
Eucalyptus grandisEucgr.J00606.1Eucgr.J00608.1Eucgr.A02118.1Eucgr.J00609.1Eucgr.G02657.1
Eucgr.J00604.1Eucgr.J00603.1Eucgr.J00605.1Eucgr.B02287.1Eucgr.B02276.1
Eucgr.A02116.1Eucgr.J00607.1
Fragaria vescamrna03614.1-v1.0-hybridmrna07689.1-v1.0-hybridmrna07690.1-v1.0-hybridmrna07985.1-v1.0-hybridmrna22463.1-v1.0-hybrid
mrna00353.1-v1.0-hybridmrna22192.1-v1.0-hybrid
Glycine maxGlyma19g29050.1Glyma10g15980.1Glyma17g24410.1Glyma15g13620.1Glyma09g02731.2
Glyma09g02731.1Glyma02g43990.2Glyma02g43990.1Glyma14g04940.2Glyma14g04940.1
Glyma02g33550.1Glyma16g04330.1Glyma19g29060.1Glyma16g04340.1Glyma02g39010.1
Glyma11g22940.2Glyma11g22940.1Glyma02g43990.3Glyma14g37070.1Glyma18g07260.2
Gossypium raimondiiGorai.009G081100.1Gorai.006G118100.2Gorai.006G118100.1Gorai.009G301800.2Gorai.009G301800.1
Gorai.013G114800.5Gorai.013G114800.4Gorai.013G114800.3Gorai.013G114800.2Gorai.013G114800.11
Gorai.013G114800.10Gorai.013G114800.1Gorai.007G260100.2Gorai.007G260100.1Gorai.007G260000.1
Gorai.013G260700.3Gorai.013G260700.2Gorai.013G260700.1Gorai.002G219500.1Gorai.009G093600.1
Gorai.013G114800.6Gorai.013G114800.8Gorai.013G114800.7Gorai.013G260700.4Gorai.013G114800.9
Gorai.013G114800.12Gorai.001G127700.1Gorai.001G127600.1
Linum usitatissimumLus10001151Lus10013646Lus10010656Lus10033393Lus10005706
Lus10010657Lus10005871Lus10001200.86.321Lus10013390Lus10022413
Lus10018102Lus10008432Lus10023604Lus10013388Lus10008434
Lus10043457Lus10034848Lus10013647
Malus domesticaMDP0000765919MDP0000196385MDP0000062066MDP0000272685MDP0000194876
MDP0000119414MDP0000140449MDP0000218589MDP0000191983MDP0000171861
MDP0000153761MDP0000121876MDP0000154790MDP0000190086MDP0000243329
MDP0000552093MDP0000163344MDP0000119413MDP0000235035MDP0000302379
Manihot esculentacassava4.1_033854mcassava4.1_024895mcassava4.1_030227mcassava4.1_003201mcassava4.1_003199m
cassava4.1_003582mcassava4.1_024363m
Medicago truncatulaMedtr3g079750.1Medtr2g030000.1Medtr7g086030.1Medtr5g069800.1Medtr7g086010.1
Medtr5g069740.1AC235673_11.1
Mimulus guttatusmgv1a002814mmgv1a003439mmgv1a002476mmgv1a002879mmgv1a002782m
mgv1a002845mmgv1a019891mmgv1a020896mmgv1a003116mmgv1a003210m
Oryza sativaLOC_Os03g53800.5LOC_Os03g53800.4LOC_Os03g53800.3LOC_Os03g53800.2LOC_Os03g53800.1
LOC_Os03g53860.5LOC_Os03g53860.4LOC_Os03g53860.3LOC_Os03g53860.2LOC_Os03g53860.1
LOC_Os02g03870.1LOC_Os01g56510.5LOC_Os01g56510.4LOC_Os01g56510.3LOC_Os01g56510.2
LOC_Os01g56510.1LOC_Os03g53790.1LOC_Os05g37700.1LOC_Os05g37700.2
Panicum virgatumPavirv00044084mPavirv00044083mPavirv00044082mPavirv00057654mPavirv00000883m
Pavirv00015776mPavirv00021236mPavirv00021235mPavirv00001262mPavirv00040732m
Pavirv00029174mPavirv00022627mPavirv00015364mPavirv00023155mPavirv00060136m
Pavirv00060135mPavirv00023191mPavirv00015460mPavirv00012515mPavirv00047960m
Pavirv00013835m
Physcomitrella patensPp1s1821_1V6.1Pp1s217_8V6.1Pp1s309_65V6.2Pp1s309_65V6.1Pp1s49_195V6.1
Phaseolus vulgarisPhvul.007G250300.1Phvul.004G050500.1Phvul.006G128800.1Phvul.008G210100.1Phvul.001G112700.1
Phvul.006G065600.1Phvul.001G112600.2Phvul.001G112600.1
Picea abiesMA_10437038g0010MA_56211g0010MA_41345g0010MA_10429527g0010MA_10435456g0010
MA_10247978g0010MA_10435456g0020MA_8496645g0010MA_10435456g0030
Populus trichocarpaPotri.019G037400.1Potri.013G055600.2Potri.013G055600.1Potri.008G013500.1Potri.019G037400.2
Potri.008G013700.1Potri.009G153900.3Potri.009G153900.1Potri.009G153900.2Potri.009G042800.2
Potri.009G042800.1Potri.009G154000.1Potri.009G154800.1Potri.009G153900.4Potri.005G059200.1
Prunus persicappa014605mppa020836mppa014607mppa002559mppa015239m
ppa002894mppa003012mppa025914mppa014895mppa026252m
ppa006354mppa018735mppa022452mppa021476m
Ricinus communis43378.m00001329976.m00048930072.m00098129852.m00202029976.m000487
29681.m00129734040.m000025
Setaria italicaSi034693mSi034691mSi034690mSi034605mSi034551m
Si034710mSi034709mSi034708mSi034705mSi034703m
Si020199mSi000575mSi020102mSi019228mSi019105m
Si004089mSi040033mSi024819mSi021490mSi035613m
Selaginella moellendorffii15726074114
Sorghum bicolorSb01g008040.3Sb01g008040.2Sb01g008040.1Sb01g008030.5Sb01g008030.4
Sb01g008030.3Sb01g008030.2Sb01g008030.1Sb03g035970.1Sb04g002570.1
Sb04g002560.1Sb04g002580.1Sb01g008050.1Sb09g022050.2Sb09g022050.1
Thellungiella halophilaThhalv10012965mThhalv10012964mThhalv10012963mThhalv10012900mThhalv10015493m
Thhalv10010277mThhalv10010212mThhalv10005832mThhalv10010213mThhalv10010219m
Vitis viniferaGSVIVT01012185001GSVIVT01037543001GSVIVT01023452001GSVIVT01023455001GSVIVT01022483001
GSVIVT01034613001GSVIVT01037542001GSVIVT01024793001GSVIVT01037547001GSVIVT01037546001
Zea maysAC197578.4_FGT001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)