y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G138400.2
FamilyGT47
Protein PropertiesLength: 669 Molecular Weight: 75271.1 Isoelectric Point: 6.2008
ChromosomeChromosome/Scaffold: 06 Start: 39490221 End: 39495968
Descriptionexostosin family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT473466660
  KKRPLIYVYDLPPEFNSLLLEGRHFKFECVNRIYDERNATLWTEQLYGSQMAMYESILASPHRTLNGEEADFFFVPVLDACIITRADDAPHLSLENHTGL
  RSSLTLEFYEKAYEHIIEKYPYWNRSAGKDHIWSFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDKIPSDRRGNHSCFDPAKDLVLPA
  WKRPDVTSLSAKLWSRPRENRKTLFYFNGNLGPAYTSGRPEATYSMGIRQKLADEFGSTPNKEGKLGKQYAEDVVVTPLRSENYHEDIANSTFCAVLPGD
  GWSGRMEDSILQGCIPVVIQV
Full Sequence
Protein Sequence     Length: 669     Download
MFSVQKWKCS WSMVATVASI IVLVSVVHLF LFPVVPSLDY FSARQVQYKC VPINSSLEQS    60
TDHVWEKKPQ GLNLDLRFPS DLHNGVVYRN APWKAEIGRW LSGCDAIATE VNIVETLGGR    120
RCKSDCSGQG VCNHELGQCR CFHGFSGEAC SERLNLSCNY PGTPELPYGR WVVSICSAHC    180
DTTRAMCFCG EGTKYPNRPV AEACGFQMNL PSEPEGAKLT DWAKADLDNI FTTNGSKPGW    240
CNVDPAAAYD SKVLFKEECD CKYDGLWGRF CEVPVESVCI NQCSGNGHCR GGFCQCYNGW    300
YGTDCSIPSV VSPIGEWPKW LKPAHLDIPS NEVTGRLVNL NAAVEKKRPL IYVYDLPPEF    360
NSLLLEGRHF KFECVNRIYD ERNATLWTEQ LYGSQMAMYE SILASPHRTL NGEEADFFFV    420
PVLDACIITR ADDAPHLSLE NHTGLRSSLT LEFYEKAYEH IIEKYPYWNR SAGKDHIWSF    480
SWDEGACYAP KEIWNSMMLV HWGNTNSKHN HSTTAYWADN WDKIPSDRRG NHSCFDPAKD    540
LVLPAWKRPD VTSLSAKLWS RPRENRKTLF YFNGNLGPAY TSGRPEATYS MGIRQKLADE    600
FGSTPNKEGK LGKQYAEDVV VTPLRSENYH EDIANSTFCA VLPGDGWSGR MEDSILQGCI    660
 PVVIQVQY*                                                           720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07974EGF_20.00528130527+
pfam03016Exostosin8.0e-48346668327+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29877.10266531694unnamed protein product [Vitis vinifera]
RefSeqNP_191322.3016651664exostosin family protein [Arabidopsis thaliana]
RefSeqNP_974452.1016651662exostosin family protein [Arabidopsis thaliana]
RefSeqXP_002277596.1026653666PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308967.1016651665predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8847592973386340
EH7566852614016610
GE5292782383676040
EY1047012334336650
FD7642842273355610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00048.1Aquca_009_00245.1Aquca_038_00127.1Aquca_025_00369.1Aquca_038_00127.2
Arabidopsis lyrata486213489149496352481698906539
472948904882
Arabidopsis thalianaAT5G22940.1AT3G57630.2AT3G57630.1AT5G61840.1AT2G28110.1
AT1G27440.1
Brachypodium distachyonBradi1g73000.1Bradi1g78027.1Bradi3g32610.1Bradi2g59400.1Bradi3g44420.1
Bradi2g59410.1Bradi2g59380.1Bradi5g08400.1
Brassica rapaBra007343Bra006644Bra002442Bra011977Bra034389
Bra030051Bra019618Bra010940Bra020202Bra010938
Carica papayaevm.model.supercontig_92.12evm.model.supercontig_92.13evm.model.supercontig_13.182evm.model.supercontig_38.66evm.model.supercontig_1.13
Capsella rubellaCarubv10016706mCarubv10001248mCarubv10023203mCarubv10026485mCarubv10009184m
Chlamydomonas reinhardtiiCre17.g721750.t1.3g6238.t1Cre03.g204050.t1.3g6362.t1Cre14.g619854.t1.2
Cre07.g325050.t1.3Cre03.g204100.t1.3Cre03.g157000.t1.3g6237.t1g10273.t1
Cre09.g390750.t1.2Cre06.g311950.t1.3Cre09.g417250.t1.2g11590.t1Cre09.g414750.t1.3
Cre03.g205250.t1.3Cre12.g561050.t1.3Cre10.g430100.t1.3Cre02.g144100.t1.2Cre03.g202550.t1.3
Cre02.g116600.t2.1Cre02.g116600.t1.2Cre02.g144050.t2.1Cre02.g144050.t1.2g13296.t1.158.456
g13296.t1.158.456g13296.t1.158.456Cre10.g430250.t1.2Cre11.g483400.t1.3Cre05.g233450.t1.2
g4741.t1Cre02.g111150.t1.3Cre13.g577400.t1.3g9003.t1g9612.t1
g13296.t1.786.965g13296.t1.786.965g13296.t1.786.965Cre13.g577050.t1.3Cre12.g502500.t1.2
Cre12.g502450.t1.3g9878.t1Cre14.g622050.t1.3Cre04.g211950.t1.3Cre02.g099400.t1.3
Citrus clementinaCiclev10004353mCiclev10031659mCiclev10028404mCiclev10005075mCiclev10005354m
Ciclev10028817mCiclev10029035m
Citrus sinensisorange1.1g003853morange1.1g005688morange1.1g005509morange1.1g008406morange1.1g048016m
orange1.1g038885m
Cucumis sativusCucsa.336860.1Cucsa.385750.1Cucsa.207490.1Cucsa.095760.1Cucsa.156870.1
Cucsa.156870.2
Eucalyptus grandisEucgr.A02396.1Eucgr.K02191.1Eucgr.G01977.1Eucgr.J00384.1
Fragaria vescamrna26458.1-v1.0-hybridmrna33411.1-v1.0-hybridmrna24598.1-v1.0-hybrid
Glycine maxGlyma10g21710.2Glyma03g29570.1Glyma02g31340.1Glyma10g21710.1Glyma12g30210.2
Glyma12g30210.1Glyma13g39700.1Glyma12g08530.6Glyma12g08530.5Glyma12g08530.4
Glyma12g08530.3Glyma12g08530.2Glyma06g17140.1Glyma04g37920.1Glyma05g33420.1
Glyma11g19910.1
Gossypium raimondiiGorai.006G138400.1Gorai.008G156000.1Gorai.009G111000.1Gorai.005G197500.1Gorai.013G269400.2
Gorai.013G269400.1Gorai.008G211000.1Gorai.008G211000.2
Linum usitatissimumLus10042357Lus10026311Lus10043326Lus10019479Lus10041343
Lus10037376Lus10043209Lus10032530
Malus domesticaMDP0000086882MDP0000311272MDP0000817103MDP0000226874MDP0000316785
MDP0000840668MDP0000206089MDP0000121803
Manihot esculentacassava4.1_010254mcassava4.1_007156mcassava4.1_024144mcassava4.1_008638mcassava4.1_008504m
cassava4.1_013685mcassava4.1_026806mcassava4.1_011607m
Medicago truncatulaMedtr4g057500.1
Mimulus guttatusmgv1a006381mmgv1a006282mmgv1a007187mmgv1a007172mmgv1a010214m
Oryza sativaLOC_Os03g01760.1LOC_Os03g07820.1LOC_Os01g70190.1LOC_Os01g70180.2LOC_Os01g70180.1
LOC_Os03g01760.2LOC_Os01g70200.1LOC_Os02g32110.1LOC_Os04g32670.1LOC_Os10g10080.2
LOC_Os10g10080.1LOC_Os10g10080.3
Panicum virgatumPavirv00003745mPavirv00003744mPavirv00054799mPavirv00015202mPavirv00009677m
Pavirv00041618mPavirv00048254mPavirv00000313mPavirv00004838mPavirv00017278m
Pavirv00059316m.13.129Pavirv00059316m.13.129Pavirv00013783mPavirv00048255mPavirv00069200m
Pavirv00004837mPavirv00031734mPavirv00024113mPavirv00024114mPavirv00023354m
Pavirv00021477mPavirv00038110mPavirv00054608mPavirv00059316m.131.264Pavirv00059316m.131.264
Physcomitrella patensPp1s217_58V6.2Pp1s217_58V6.1Pp1s13_216V6.1Pp1s110_97V6.1Pp1s315_20V6.1
Pp1s7_455V6.1
Phaseolus vulgarisPhvul.007G255200.1Phvul.005G130800.1Phvul.011G085300.1Phvul.002G281100.1Phvul.009G160700.1
Picea abiesMA_10429529g0010MA_10436102g0010MA_18829g0010
Populus trichocarpaPotri.006G054800.1Potri.012G109600.1Potri.009G006500.1Potri.003G162000.1Potri.001G068100.2
Potri.001G068100.1Potri.012G109200.1Potri.015G116700.1Potri.001G068100.3Potri.015G116700.2
Prunus persicappa001595mppa005437mppa006418mppa008207m
Ricinus communis27810.m00064429589.m00124730147.m01439730128.m00856530128.m008564
Setaria italicaSi034324mSi035828mSi001622mSi001623mSi022172m
Si001579mSi022174mSi017280mSi009832mSi022143m
Selaginella moellendorffii4427235415442111
Sorghum bicolorSb01g045550.2Sb01g045550.1Sb01g050110.1Sb04g021180.1Sb03g044530.1
Sb09g027440.1Sb03g044510.1Sb03g044520.1Sb09g027450.1Sb06g014730.1
Sb09g022500.1
Thellungiella halophilaThhalv10005794mThhalv10013464mThhalv10016649mThhalv10007763mThhalv10004300m
Thhalv10016978mThhalv10017970m
Vitis viniferaGSVIVT01033325001GSVIVT01031485001GSVIVT01008661001GSVIVT01001097001
Volvox carteriVocar20000771mVocar20012246m.303.655Vocar20012246m.303.655Vocar20008669mVocar20007830m
Vocar20002407mVocar20006369mVocar20012208mVocar20003734mVocar20003733m
Vocar20009740mVocar20000485mVocar20000433mVocar20011523mVocar20005616m
Vocar20013770mVocar20002011mVocar20012823mVocar20005376mVocar20011529m
Vocar20011583mVocar20010952mVocar20005743mVocar20001869mVocar20005584m
Vocar20014463mVocar20009656mVocar20001757m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)